KEGG   Enterobacter cancerogenus: CWI88_14355Help
Entry
CWI88_14355       CDS       T05545                                 

Definition
(GenBank) glutamine synthetase
  KO
K09470  gamma-glutamylputrescine synthase [EC:6.3.1.11]
Organism
ecan  Enterobacter cancerogenus
Pathway
ecan00330  Arginine and proline metabolism
ecan01100  Metabolic pathways
Module
ecan_M00136  GABA biosynthesis, prokaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:ecan00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    CWI88_14355
Enzymes [BR:ecan01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.1  Acid-D-ammonia (or amine) ligases (amide synthases)
    6.3.1.11  glutamate---putrescine ligase
     CWI88_14355
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Gln-synt_C Gln-synt_N_2
Motif
Other DBs
NCBI-ProteinID: AUJ82161
UniProt: A0A2J7P5A1
Position
complement(2992722..2994140)
Genome map
AA seq 472 aa AA seqDB search
METNIVEVENFVQQSEERRGSAFSQEVKRYLENYPNTQFIDVLLTDLNGCFRGKRIPVAG
LSKLEKGCYFPASVFAMDILGNVVEEAGLGQELGEPDCTCVPVPGTLTPSAADPEYIGQV
QLTMIDEDGAPFDVEPRNVLNRLWQQLRQRGLFPVVAVELEFYLLDRKRDAEGYLQPPCA
PGTDVRNTQSQVYSVDNLNHFADVLNDIDELAQLQLIPADGAVAEASPGQFEINLHHTEN
VLDACDDALALKRLVRLMAEKHKMHATFMAKPYEEHAGSGMHIHISMQNSKGENVLADKD
GEDSALLKRALAGMIDLMPASMALLAPNVNSYRRFQPGMYVPTQASWGHNNRTVALRIPC
GDRHNHRVEYRVAGADANPYLVMAAIFAGILHGLDNDLPLQEEVEGNGLEQDGLPFPIRQ
SDALWTFMQNDDLRERLGERFCHVYHACKNDELLQFERLITETEIEWMLKNA
NT seq 1419 nt NT seq  +upstreamnt  +downstreamnt
atggaaaccaatatcgtagaagttgagaactttgtgcagcagtcggaagagaggcggggc
agcgcatttagccaggaggtgaagcgctatctggaaaactatccgaatacccagtttatc
gacgtactgcttaccgatttgaacgggtgtttccgcggcaagcgcattccggttgctggc
ctgagcaagctggaaaaaggctgctacttcccggcgtcggtctttgccatggacattctc
ggtaatgtggtggaagaggccggattagggcaggagctgggtgagccggattgcacctgc
gtcccggtgccgggcaccttaaccccgtcagccgccgaccctgaatatattggtcaggtt
cagctgacgatgattgatgaagatggcgctccctttgacgttgagccacggaacgttctc
aaccgactctggcagcagctgcgccagcgcggtctgttcccggtggtagcggtagagctg
gagttctatttactcgatcgcaagcgcgacgccgaagggtatctccagccaccgtgcgcg
ccgggtaccgacgtgcgtaatacccagagccaggtctattccgtcgacaaccttaaccac
tttgccgacgtgctgaacgacattgacgagctggcgcagctccagctgatccccgccgat
ggcgcggtggcggaagcgtcgccggggcagtttgaaatcaaccttcaccataccgaaaac
gtgcttgatgcctgcgatgatgcgctggccttaaaacgtctcgtgcgtctgatggcggaa
aaacataagatgcacgccacgtttatggcgaagccgtacgaagagcatgcgggaagcggg
atgcacatccacatcagcatgcaaaacagcaaaggcgagaacgtgctggctgataaagac
ggggaagattccgcgctgctgaagcgggcgctggcggggatgatcgacctgatgcccgca
tcgatggcgctgctggcacccaacgtcaattcgtatcgccgtttccagccggggatgtat
gtgccaacccaggcgtcctgggggcataacaaccgcacggttgccctgcgcattccgtgt
ggcgatcgccataaccatcgcgtcgagtatcgtgtggcgggagcggatgctaacccgtat
ctggtgatggccgccatcttcgccgggattctgcacgggctggacaatgatttaccgctg
caggaagaagtggaaggtaatgggcttgagcaggacgggctgccgttccctatccgccag
agcgacgcgctgtggacgtttatgcaaaacgacgatctgcgcgaacgtctgggcgagcgt
ttctgccatgtttatcacgcctgcaaaaacgatgaactgctgcagtttgagcgtcttatc
acagaaaccgaaattgagtggatgttgaaaaacgcctga

DBGET integrated database retrieval system