KEGG   Enterobacter cancerogenus: CWI88_17495Help
Entry
CWI88_17495       CDS       T05545                                 

Definition
(GenBank) ACP phosphodiesterase
  KO
K08682  acyl carrier protein phosphodiesterase [EC:3.1.4.14]
Organism
ecan  Enterobacter cancerogenus
Pathway
ecan00770  Pantothenate and CoA biosynthesis
Brite
KEGG Orthology (KO) [BR:ecan00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    CWI88_17495
Enzymes [BR:ecan01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.14  [acyl-carrier-protein] phosphodiesterase
     CWI88_17495
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ACP_PD
Motif
Other DBs
NCBI-ProteinID: AUJ82742
UniProt: A0A2I6E8Q6
Position
3672738..3673319
Genome map
AA seq 193 aa AA seqDB search
MNFLAHLHLAHLAESSLSGNLLADFVRGNPAEAYSAEVVEGIFMHRRIDVLTDNLPEVTE
AKAWFRPETRRVAPITLDVMWDHFLSRHWEQLSPNLPLPEFVRYARQQVAIILPDSPPRF
VNLNNYLWSERWLERYREMDFIQNVLNGMASRRPRLDALRDSWHDLDTHYDALESRFWQF
YPRMMAQAKNKQL
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atgaattttctcgctcacctgcatcttgctcatctcgctgaaagctctttatccggcaac
ctgctggccgatttcgtgcgcggcaaccccgccgaggcgtattccgcagaggttgtcgaa
gggatctttatgcatcgccggatcgacgttctgaccgataacctgccggaagtgaccgaa
gcgaaagcatggttccgccccgaaacacgccgcgtcgcgccaattacgctcgacgtcatg
tgggatcacttcctgtcgcgccactgggaacagctgtcgccgaacctgccgctgccggaa
tttgtacgctatgcccgtcagcaggtggcgataattttaccggactccccgccgcgtttt
gtcaatctcaacaactatctgtggtctgaacgctggctggagcggtatcgcgagatggat
tttatccagaacgtcctgaacggcatggccagccgccgcccgcgtctcgatgcgctacgc
gattcctggcacgacctggacacgcactacgatgcgctcgagagccgtttctggcagttc
tacccgcgcatgatggcgcaggcgaaaaacaaacagctgtaa

DBGET integrated database retrieval system