KEGG   Enterococcus casseliflavus: ECBG_00421Help
Entry
ECBG_00421        CDS       T02623                                 

Definition
(GenBank) hypothetical protein
  KO
K01207  beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
ecas  Enterococcus casseliflavus
Pathway
ecas00520  Amino sugar and nucleotide sugar metabolism
ecas01100  Metabolic pathways
ecas01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:ecas00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    ECBG_00421
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    ECBG_00421
Enzymes [BR:ecas01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     ECBG_00421
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_3 Presenilin Spore_coat_CotO
Motif
Other DBs
NCBI-GeneID: 15141636
NCBI-ProteinID: EEV38152
UniProt: C9A6P1
Position
1144258..1145463
Genome map
AA seq 401 aa AA seqDB search
MGLFLFLVLAAMGGMKWMIEQQKQQTEEPAMIQQSSLRDETQEESRESQEPTSVSTSASV
TTSTQEQPEEAIAEKIATMSLEEKVGQLFFVRVPESNQIEELQKYHFGGYLLFGRDTENE
TAASLKQKISDYQAASAIPLLIGMDEEGGTVTRISRNPNLTDQRFLSPQQLYAQGGWSAI
EEDTAKKVEILKAYGINAGLFPVADVSTDPQSFIYDRTIGMDAQGTSAFVERVVHVLQIH
HVGSTLKHFPGYGNNRDSHVEIVTDDRPLSALRETDFLPFAAGIKAGANSILVAHTIVNS
IDKTVPASISKPVHELLRNELHFKGVIMTDDLDMAGLSEFIPQKEAALQALQAGNDLVIS
STYQEQIPFVVQAVEDGRYLEADLNASVKRVLLWKEALHLL
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgggactgtttcttttcttggtcttagcagcaatgggagggatgaagtggatgatagaa
cagcaaaaacagcaaaccgaagagccagccatgatccagcaaagcagcttgagggacgaa
acacaggaagaaagcagggaaagtcaggaacccacctcagtttccacgtcagcttctgtt
acaacttccacgcaagaacagccagaagaggcaatagcagaaaaaatcgccacgatgagt
ttggaggaaaaggtcgggcaattgttttttgtgcgtgtgccagaaagcaatcaaatcgaa
gagcttcaaaagtatcactttggtggctatctgttattcggccgtgataccgaaaatgag
acggcggcgagcttgaaacagaaaatttcagattaccaagcagccagcgccatcccgctg
ttgatcggtatggatgaagaagggggcacagtgactcgcatcagccgcaatccgaacctt
acggatcagcgttttctctcaccacaacagctgtatgcccaaggtggatggtcagcgatc
gaagaagatacagcaaagaaagtggaaattttaaaagcttacggcatcaatgctgggctg
tttcccgttgccgatgtttccactgatccgcagtcctttatctacgaccgaaccattggc
atggatgcgcagggcacgagtgcgtttgtagaacgtgtggttcatgttttacagatacac
cacgttgggtctaccttgaagcattttcctggctatggcaacaatcgtgactcgcatgtc
gaaatcgtcaccgatgaccgcccgctatctgcactgcgggaaacggattttctgcctttt
gccgcagggatcaaagctggtgccaatagtattttggtcgcccatacgatcgtcaatagt
atcgataagaccgtacccgcctctatttcaaaacccgtgcatgagctgctgcgaaatgaa
ttgcattttaaaggggtcatcatgacggatgacttggatatggcaggactttctgagttc
attccgcaaaaagaagccgcattacaggcgttgcaggcgggaaatgatctagtgatctcc
tctacctatcaagaacagattccttttgtagtacaagcggttgaagatggccgctattta
gaagctgatttgaatgcttccgtcaaacgggtcttgctctggaaagaagcattgcattta
ctttaa

DBGET integrated database retrieval system