KEGG   Enterococcus casseliflavus: ECBG_01864Help
Entry
ECBG_01864        CDS       T02623                                 

Definition
(GenBank) ornithine carbamoyltransferase
  KO
K00611  ornithine carbamoyltransferase [EC:2.1.3.3]
Organism
ecas  Enterococcus casseliflavus
Pathway
ecas00220  Arginine biosynthesis
ecas01100  Metabolic pathways
ecas01110  Biosynthesis of secondary metabolites
ecas01130  Biosynthesis of antibiotics
ecas01230  Biosynthesis of amino acids
Module
ecas_M00844  Arginine biosynthesis, ornithine => arginine
Brite
KEGG Orthology (KO) [BR:ecas00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    ECBG_01864
Enzymes [BR:ecas01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.3  ornithine carbamoyltransferase
     ECBG_01864
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace OTCace_N XPG_I
Motif
Other DBs
NCBI-GeneID: 15142716
NCBI-ProteinID: EEV39595
UniProt: C9A4C9
Position
complement(2319306..2320319)
Genome map
AA seq 337 aa AA seqDB search
MTSVFKGRSFLAEKDFTKEELQYLIDFSQHLKGMKANNQPHRYLEGKNIALLFEKNSTRT
RAAFTVAAVDLGAHPEFLGANDIQLGSKESVEDTAKVFGRMFDGIEFRGFSQQVVEDLAN
YSGVPVWNGLTDEWHPTQMIADFLTIQENFGELTGLTIAYCGDGRNNVANSLLVTSAILG
VNIHVVTPKALQPEATIIAQAQAYAKQSGAKILVTDDVDQGVLGADVVYTDVWVSMGEEE
KFQERIEQLLPYQVNQSLMKKTQNDQVIFMHCLPAFHDDQTTYGKKAAQAYGISEMEVTD
EVFRSKYARQFDQAENRLHSIKAIMAVTAGDLFIPKV
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgacatcggtttttaaaggacgcagttttttagcagaaaaggattttacaaaagaagaa
ctacaatatttgattgatttttcccagcacttgaaagggatgaaggccaacaatcaacca
catcgctacttagaaggaaaaaatattgcacttttgtttgaaaagaattcgacacggacg
cgagcagcctttacggttgcagcggtggatctgggggcacatccggaatttttaggggcc
aatgatattcagttggggtctaaagaatccgttgaagataccgccaaagtattcggccgc
atgttcgacgggatcgagtttcgcggctttagtcaacaggttgtcgaagatctggccaac
tattcaggtgtacctgtttggaatggcttaacggatgaatggcatccaacgcaaatgatt
gctgactttttgaccattcaagaaaactttggtgagctgactggcttgaccatcgcatac
tgtggggatgggcgcaacaatgtcgccaattctttgttagtgaccagtgcgattttaggg
gtcaatattcatgtcgtcaccccgaaggccttgcagccagaagcaaccatcatcgcacag
gcacaagcctatgccaagcaatcgggcgcaaagattttggtgactgatgatgtggatcaa
ggtgttctaggcgctgatgtcgtgtataccgatgtttgggtatcaatgggtgaagaagaa
aaattccaagagcggattgaacagctgctgccgtatcaagtcaaccaatcgttgatgaaa
aaaacacaaaacgatcaagtgatttttatgcattgtttgccagcatttcatgatgatcag
accacctatggcaaaaaagcagcgcaggcgtatggaatttctgagatggaagtcactgat
gaggtctttcgcagtaagtatgcccgtcaatttgatcaagccgaaaatcgtttgcactca
atcaaagcgatcatggcagtgactgctggagatttatttattcctaaagtataa

DBGET integrated database retrieval system