KEGG   Enterococcus casseliflavus: ECBG_02519Help
Entry
ECBG_02519        CDS       T02623                                 

Definition
(GenBank) hypothetical protein
  KO
K09988  D-lyxose ketol-isomerase [EC:5.3.1.15]
Organism
ecas  Enterococcus casseliflavus
Pathway
ecas00040  Pentose and glucuronate interconversions
Brite
KEGG Orthology (KO) [BR:ecas00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    ECBG_02519
Enzymes [BR:ecas01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.15  D-lyxose ketol-isomerase
     ECBG_02519
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Lyx_isomer
Motif
Other DBs
NCBI-GeneID: 15143244
NCBI-ProteinID: EEV40250
UniProt: C9ABJ1
Position
complement(2861133..2861651)
Genome map
AA seq 172 aa AA seqDB search
MNYQKRVRQLFEQSGFIFSDKELQSIDFADFGLGNIEEEGLNLIVYINNDRYCAKEMVLL
PYQTCPEHLHPTIGERLGKQETFRCRWGKVYLYVEGNNQKETIRSTIPKKNEQFYTVYTE
IELLPGQQYTIDPDTKHWFQAAATGAVISEFSSPSDDASDIFTNPSIQRVIQ
NT seq 519 nt NT seq  +upstreamnt  +downstreamnt
atgaattatcaaaaacgagtaagacagttatttgagcaatcgggattcattttttctgat
aaagaattacagtcaatcgattttgctgatttcggcttaggaaacattgaagaagaagga
ttaaatctgattgtctatattaataatgaccgatattgtgctaaagaaatggttctttta
ccttatcagacgtgtccagaacatttacacccaacaattggtgagaggcttggaaagcaa
gaaacttttcgttgtcgttggggaaaagtgtatttatatgtcgaaggaaacaatcaaaaa
gagacgataagaagcactattcctaaaaaaaatgagcagttttataccgtgtatactgag
attgaattattgcccggacagcagtacaccattgatcctgatacgaaacactggtttcaa
gctgccgctactggagcagtgatttctgaattttcttctcctagtgatgatgcgagcgat
atctttactaatccatcgatacaacgggtaatccaatag

DBGET integrated database retrieval system