KEGG   Enterococcus casseliflavus: ECBG_03037Help
Entry
ECBG_03037        CDS       T02623                                 

Definition
(GenBank) oxaloacetate decarboxylase
  KO
K01571  oxaloacetate decarboxylase (Na+ extruding) subunit alpha [EC:7.2.4.2]
Organism
ecas  Enterococcus casseliflavus
Pathway
ecas00620  Pyruvate metabolism
ecas01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ecas00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    ECBG_03037
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ecas02000]
    ECBG_03037
Enzymes [BR:ecas01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.4  Linked to decarboxylation
    7.2.4.2  oxaloacetate decarboxylase (Na+ extruding)
     ECBG_03037
Transporters [BR:ecas02000]
 Other transporters
  Primary active transporters [TC:3]
   ECBG_03037
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PYC_OADA HMGL-like
Motif
Other DBs
NCBI-GeneID: 15143667
NCBI-ProteinID: EEV40768
UniProt: C9AD09
Position
3288599..3289990
Genome map
AA seq 463 aa AA seqDB search
MKKIQFTETVLRDGQQSLIATRMPTSDMLPILKTMDQAGYHALEMWGGATFDACLRFLNE
DPWERLRAIRKEVKKTKLQMLLRGQNLLGYKNYADDVVADFVTKSVENGIDILRLFDALN
DVRNLETAIRAAKAAGGHCQTAISYTTSQIHTVDYFVDLANKMADLGADSICIKDMAGVL
TPQTGYELVSRIKDAVDLPLEVHTHATSGIAEMTYLKVAEAGADIIDTAISSFAGGTSQP
ATESVAIALEDCGFATGLDLQKAAEIAEHFNPVRDRFREEGLLNPKVKDIEPKTLIYQVP
GGMLSNLLSQLTEQGLQDKYEEVLAEVPKVRADLGYPPLVTPLSQMVGTQALMNVISGER
YKLVPSEIKDYVKGLYGQSPAPISEEIKETIIGDAEVITVRPADLLAPQLPAFKEEIAEY
AKSEEDVLMYALFPQQAQDFLGRREDPFYDVPVQTVSVRIAVD
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaatccaatttaccgaaaccgtcttgcgggacggccaacaaagtctgatcgct
acacgaatgcctaccagcgatatgctgccgattctaaaaaccatggaccaagcaggctac
catgccctggaaatgtggggcggcgcgaccttcgatgcttgtctgcgttttttaaatgaa
gacccatgggaaagattgcgggcgatccgcaaagaagtgaaaaagaccaaactgcaaatg
ctcttacggggacaaaatctcttaggttacaaaaactatgccgatgacgtcgttgctgac
tttgtgaccaaatcggtcgaaaacggcatcgacattcttcgtttgtttgatgctttaaat
gatgtccgcaatttggaaaccgccatccgtgccgcaaaagcagccggtggacactgtcaa
acggcgatctcttatactactagccagatccataccgtggattacttcgtcgaccttgcc
aacaaaatggcagacctcggcgcagattctatctgtatcaaagatatggcaggcgttttg
acgccgcaaaccggctatgagctggtcagccgaatcaaagacgcggtcgatctgccgctg
gaagtccatacccatgccaccagcggcattgctgagatgacttacttgaaagttgcggaa
gctggcgcagacatcattgatactgccatctcctcttttgctggcggcaccagtcagcca
gcgaccgaatctgtggcgatcgccttagaagattgcggctttgctacgggacttgattta
cagaaagccgctgagattgcagaacatttcaatcccgttcgtgatcgtttccgtgaagaa
gggctgctgaatccaaaagtcaaagacatcgaacccaaaaccttgatctatcaagtacct
ggcggcatgttgtcgaacctactcagccaattgacggaacaaggattgcaagacaagtat
gaagaagtcttagcagaggtaccaaaagtcagagcggacttgggttatccaccgctagtg
accccattgtcgcaaatggtcggcactcaagccttgatgaatgtaatttcaggagaacgc
tacaaacttgtcccaagtgagatcaaagattacgtcaaaggactttatggacaatcgcca
gcacccatcagcgaagaaatcaaagaaacaattatcggagatgctgaagtgatcactgtc
agaccagctgatctactggcaccgcaattgccagccttcaaggaagaaatcgctgagtat
gccaaaagcgaagaagacgtgctgatgtacgccctcttccctcagcaagcccaagacttt
ttaggccgacgagaagatcctttttatgatgtccccgtacagacagtgtctgtgaggatt
gcggtggattaa

DBGET integrated database retrieval system