KEGG   Enterococcus casseliflavus: ECBG_04249Help
Entry
ECBG_04249        CDS       T02623                                 

Definition
(GenBank) acetyl-CoA C-acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
ecas  Enterococcus casseliflavus
Pathway
ecas00071  Fatty acid degradation
ecas00072  Synthesis and degradation of ketone bodies
ecas00280  Valine, leucine and isoleucine degradation
ecas00310  Lysine degradation
ecas00362  Benzoate degradation
ecas00380  Tryptophan metabolism
ecas00620  Pyruvate metabolism
ecas00630  Glyoxylate and dicarboxylate metabolism
ecas00640  Propanoate metabolism
ecas00650  Butanoate metabolism
ecas00900  Terpenoid backbone biosynthesis
ecas01100  Metabolic pathways
ecas01110  Biosynthesis of secondary metabolites
ecas01120  Microbial metabolism in diverse environments
ecas01130  Biosynthesis of antibiotics
ecas01200  Carbon metabolism
ecas01212  Fatty acid metabolism
ecas02020  Two-component system
Brite
KEGG Orthology (KO) [BR:ecas00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    ECBG_04249
   00630 Glyoxylate and dicarboxylate metabolism
    ECBG_04249
   00640 Propanoate metabolism
    ECBG_04249
   00650 Butanoate metabolism
    ECBG_04249
  09103 Lipid metabolism
   00071 Fatty acid degradation
    ECBG_04249
   00072 Synthesis and degradation of ketone bodies
    ECBG_04249
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    ECBG_04249
   00310 Lysine degradation
    ECBG_04249
   00380 Tryptophan metabolism
    ECBG_04249
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    ECBG_04249
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    ECBG_04249
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    ECBG_04249
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ecas04147]
    ECBG_04249
Enzymes [BR:ecas01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     ECBG_04249
Exosome [BR:ecas04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   ECBG_04249
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HMG-CoA_red Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-GeneID: 15142785
NCBI-ProteinID: AGJ01202
UniProt: M9T8C8
Position
complement(2380788..2383262)
Genome map
AA seq 824 aa AA seqDB search
MEEVVIIDALRTPIGKYHGSLKEYTAVKLGTVAAKALLARNQQAKEHIAQVIIGNVLQAG
SGQNPGRQVSLQSGLSSDIPASTINEVCGSGMKAILMGMEQIQLNKASVVLTGGIESMTN
APLFSYYNKAEDQYSAPVSTMMHDGLTDAFSSKPMGLTAETVAERYGITRKEQDEFAYHS
QMKAAKAQAAKKFDQEIVPLTEKSGTVLQDEGIRAATTVEKLAELKTVFKKDGTVTAGNA
STINDGAAMVLIASKSYCEEHQIPYLAVIKEIVEVGFAPEIMGISPIKAIDTLLKKQALT
IEDIGIFEINEAFAASSIVVERELGLDPKKVNRYGGGISLGHAIGATGARIATTVAYQLK
DTQERYGIASLCVGGGLGLAMLLENPSATASQTNFDEESASEKTEKKKFYALAPNERLAF
LEAQGAITAAESLVFQEMTLNKETANHLIENQISEVEIPLGVGLNLQMNGKAYNVPLATE
EPSVIAAMSNGAKMAGPITTTSQERLLRGQIVFMDVQDPEAILAKVESEQAAIFAVANET
YPSIVKRGGGLRRVIGRNFSPAESDLATAYVSIDLMVDVKDAMGANIINSILEGVAELFR
KWFPEEEILFSILSNLATESLVTATCLVPFDKLSKTGNGRQVAEKIVHAADFSKIDPYRA
ATHNKGIMNGVEALILATGNDTRAVSAACHGYAARNGRMQGLTSWTIIEDRLIGSITLPL
AIATVGGATKILPKAQAALALTGVETASELASLAASVGLVQNLAALRALVSEGIQQGHMS
MQARSLAISVGAKGTEIEQLAAKLRAATQMNQEQARKFLTEIRN
NT seq 2475 nt NT seq  +upstreamnt  +downstreamnt
gtggaagaagttgtcattatcgacgcactaagaacgccaattggcaaataccatgggtca
ttaaaagaatatacagcggtaaaattaggaacagtcgctgcaaaagccttgttggcaaga
aaccaacaagcaaaagaacatatcgcacaagtgattatcggaaatgtgctacaagcaggc
agtggtcaaaatccaggacgccaagtttccttgcaaagtgggctttcctcagatattcca
gcctcaacgatcaacgaagtatgtggttcgggaatgaaagcgattctaatggggatggag
caaattcaattgaacaaggcatccgtcgtattgactggtgggattgaaagtatgacgaat
gcgccgctctttagttattataacaaggcggaagatcagtattcagctccggtgtcaaca
atgatgcatgacggattaacagatgctttcagcagtaagccaatgggactgacggctgag
acggtagcagaaagatacgggatcactcgcaaagagcaagatgagtttgcctaccactca
caaatgaaagctgccaaagcgcaagcagcaaagaaatttgatcaagagatcgtgccgttg
actgaaaaatcaggaaccgttttacaggacgaaggcattcgcgccgctacgacagtcgaa
aaattagctgaattaaaaacagttttcaaaaaagacggtacggtgactgctgggaacgcc
tcaaccatcaatgatggggcggccatggtcttgatcgcgtcaaaaagctattgtgaagag
catcagattccttatctggcagtgatcaaagagatcgtcgaagtcggtttcgccccagag
atcatgggaatctcaccaatcaaagcaatcgatacgttactgaaaaagcaagcactgacg
attgaagatatcggtatttttgagatcaatgaagcctttgcagcttcttcgatcgtagta
gaacgtgaacttggtttggatccgaagaaagtcaaccgttacggcgggggcatttcactg
ggacatgccattggagcgactggcgcgcggatcgcaacgaccgtcgcttatcagctaaaa
gacacccaagagcgctatggaatcgcctctttgtgtgtcggtggcggattagggctagcg
atgctgttagaaaatccttcggcgacagcaagtcaaacgaattttgatgaagagtcggca
tcagaaaaaacagaaaaaaaaaagttctacgccctcgcgcctaatgaacgactagccttt
cttgaagcacaaggagcgatcacagcagcagaatccttagtttttcaagaaatgacgcta
aacaaggaaactgctaatcacttgatcgaaaaccaaatcagtgaagtagagatcccgtta
ggcgtagggctgaacctgcagatgaatggcaaagcatacaatgtcccgttagccacagaa
gaaccctcggtgatcgcagcgatgagcaatggagcaaaaatggctgggcccattacgacg
accagtcaagaacgtttgcttcgaggccagatcgtctttatggatgttcaggatccggaa
gcgattttggcaaaagttgaatccgagcaagcagcgatctttgcagtggcgaatgagacg
tatccttccatcgtgaaacgcggcggtggattgcgaagagtgatcggtcggaacttctcg
ccagcagaatctgacttagcaaccgcttatgtgtcgatcgatttaatggttgatgtcaaa
gatgcgatgggcgccaatatcatcaattcaattttagaaggagtggcagagctttttcgc
aaatggttcccagaagaagaaattctctttagtattttaagcaatctcgctacggaatcg
ttagtaacagccacttgcttggtgccttttgacaaattgagcaagaccggaaatggcaga
caagttgccgaaaaaattgttcatgcagctgatttttccaagatcgatccatatcgtgcc
gctacccataacaaagggatcatgaatggggttgaagcgctgattttggctaccggaaac
gacactcgcgccgtttctgccgcttgtcatggctatgctgcccgtaatggccgtatgcaa
gggttgacttcctggaccatcatagaagaccgtttgattggtagtatcacactgccgttg
gcgatcgccacagtcgggggtgccacaaaaatattgccaaaagcccaagctgcgttggca
ttgactggtgttgaaacggcgagtgagttagcttcgctggcggcaagtgtcgggttggtt
cagaatctggccgcgttgcgggcattggtttcagaaggtatccagcaaggccatatgagc
atgcaagcccgttcattagctatttcagttggagcaaaaggaaccgagattgaacagctg
gcagctaagctgcgagctgcgactcaaatgaaccaagagcaagcccgtaaatttttaacc
gaaatacgcaattaa

DBGET integrated database retrieval system