KEGG   Equus caballus (horse): 100009689Help
Entry
100009689         CDS       T01058                                 

Gene name
BDNF
Definition
(RefSeq) brain-derived neurotrophic factor precursor
  KO
K04355  brain-derived neurotrophic factor
Organism
ecb  Equus caballus (horse)
Pathway
ecb04010  MAPK signaling pathway
ecb04014  Ras signaling pathway
ecb04024  cAMP signaling pathway
ecb04151  PI3K-Akt signaling pathway
ecb04722  Neurotrophin signaling pathway
ecb05016  Huntington's disease
ecb05030  Cocaine addiction
ecb05034  Alcoholism
Brite
KEGG Orthology (KO) [BR:ecb00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    100009689 (BDNF)
   04010 MAPK signaling pathway
    100009689 (BDNF)
   04024 cAMP signaling pathway
    100009689 (BDNF)
   04151 PI3K-Akt signaling pathway
    100009689 (BDNF)
 Organismal Systems
  Nervous system
   04722 Neurotrophin signaling pathway
    100009689 (BDNF)
 Human Diseases
  Neurodegenerative diseases
   05016 Huntington's disease
    100009689 (BDNF)
  Substance dependence
   05030 Cocaine addiction
    100009689 (BDNF)
   05034 Alcoholism
    100009689 (BDNF)
Cytokines and growth factors [BR:ecb04052]
 Growth factors
  Growth factors (RTK binding)
   100009689 (BDNF)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NGF Spaetzle
Motif
Other DBs
NCBI-GeneID: 100009689
NCBI-ProteinID: NP_001075256
Ensembl: ENSECAG00000015952
UniProt: Q0EAB7
Position
7
AA seq 247 aa AA seqDB search
MTILFLTMVISYFGCMKAAPMKEANARGQGSLAYPAVRTHGTLESVNGPKAGSRGLTSLA
DTFEHVIEDLLDEGQKVRPDEENSKDADLYTSRVMLSSQVPLEPPLLFLLEEYKNYLDAA
NMSMRVRRHSDPARRGELSVCDSISEWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQY
FYETKCNPMGYTKEGCRGIDKRHWNSQCRTTQSYVRALTMDSKKRIGWRFIRIDTSCVCT
LTIKRGR
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgaccatccttttccttactatggttatttcatacttcggttgcatgaaggctgccccc
atgaaagaagcaaacgcccgaggacaaggcagcttggcctacccagctgtgcggacccat
gggactctggagagcgtgaacgggcccaaggcaggctcgagaggcctgacctcgttggct
gacactttcgaacacgtgatagaagacctgttggatgagggccagaaagtgcggcccgat
gaagagaacagtaaggacgcggacttgtacacttcccgggtgatgctcagtagtcaagtg
cctttggagcctccccttctctttctgctggaggaatacaaaaattacctggatgctgca
aacatgtctatgagggtccggcgccactctgacccggcccgccgcggggagctgagcgtc
tgcgacagcattagcgagtgggtcaccgcggcggataagaagacggcagtggacatgtcg
ggcgggacggtcacggtcctggaaaaggtccctgtgtcgaaaggccagctgaagcagtac
ttctatgagaccaagtgcaaccccatgggttacacgaaggagggctgcaggggcatcgac
aaaaggcactggaactcccaatgccgaactacccagtcgtacgtgcgggccctcaccatg
gatagcaaaaagagaatcggctggcggttcataaggatagacacttcctgtgtatgtaca
ttgaccattaaaaggggaagatag

DBGET integrated database retrieval system