KEGG   Equus caballus (horse): 100033839Help
Entry
100033839         CDS       T01058                                 

Gene name
VEGFA
Definition
(RefSeq) vascular endothelial growth factor A precursor
  KO
K05448  vascular endothelial growth factor A
Organism
ecb  Equus caballus (horse)
Pathway
ecb01521  EGFR tyrosine kinase inhibitor resistance
ecb04010  MAPK signaling pathway
ecb04014  Ras signaling pathway
ecb04015  Rap1 signaling pathway
ecb04066  HIF-1 signaling pathway
ecb04151  PI3K-Akt signaling pathway
ecb04370  VEGF signaling pathway
ecb04510  Focal adhesion
ecb04926  Relaxin signaling pathway
ecb04933  AGE-RAGE signaling pathway in diabetic complications
ecb05163  Human cytomegalovirus infection
ecb05165  Human papillomavirus infection
ecb05167  Kaposi's sarcoma-associated herpesvirus infection
ecb05200  Pathways in cancer
ecb05205  Proteoglycans in cancer
ecb05206  MicroRNAs in cancer
ecb05211  Renal cell carcinoma
ecb05212  Pancreatic cancer
ecb05219  Bladder cancer
ecb05323  Rheumatoid arthritis
ecb05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ecb00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    100033839 (VEGFA)
   04015 Rap1 signaling pathway
    100033839 (VEGFA)
   04010 MAPK signaling pathway
    100033839 (VEGFA)
   04370 VEGF signaling pathway
    100033839 (VEGFA)
   04066 HIF-1 signaling pathway
    100033839 (VEGFA)
   04151 PI3K-Akt signaling pathway
    100033839 (VEGFA)
 Cellular Processes
  Cellular community - eukaryotes
   04510 Focal adhesion
    100033839 (VEGFA)
 Organismal Systems
  Endocrine system
   04926 Relaxin signaling pathway
    100033839 (VEGFA)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    100033839 (VEGFA)
   05206 MicroRNAs in cancer
    100033839 (VEGFA)
   05205 Proteoglycans in cancer
    100033839 (VEGFA)
   05212 Pancreatic cancer
    100033839 (VEGFA)
   05211 Renal cell carcinoma
    100033839 (VEGFA)
   05219 Bladder cancer
    100033839 (VEGFA)
  Immune diseases
   05323 Rheumatoid arthritis
    100033839 (VEGFA)
  Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    100033839 (VEGFA)
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    100033839 (VEGFA)
  Infectious diseases
   05163 Human cytomegalovirus infection
    100033839 (VEGFA)
   05167 Kaposi's sarcoma-associated herpesvirus infection
    100033839 (VEGFA)
   05165 Human papillomavirus infection
    100033839 (VEGFA)
  Drug resistance
   01521 EGFR tyrosine kinase inhibitor resistance
    100033839 (VEGFA)
Cytokines and growth factors [BR:ecb04052]
 Growth factors
  Growth factors (RTK binding)
   100033839 (VEGFA)
Glycosaminoglycan binding proteins [BR:ecb00536]
 Heparan sulfate/Haparin
  Growth factors/receptors (General comment) Ligand-receptor clustering and signaling, cell migration, mitogenesis
   100033839 (VEGFA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: VEGF_C PDGF
Motif
Other DBs
NCBI-GeneID: 100033839
NCBI-ProteinID: NP_001075290
Ensembl: ENSECAG00000009402
UniProt: Q9GKR0
Position
20
AA seq 190 aa AA seqDB search
MNFLLSWVHWSLALLLYLHHAKWSQAAPMAEGEHKTHEVVKFMDVYQRSYCRPIETLVDI
FQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTAEFNITMQIMRIKPHQSQHIGEMS
FLQHSKCECRPKKDKARQENPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNE
RTCRCDKPRR
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
atgaactttctgctctcttgggtgcattggagccttgccttgctgctctacctccaccat
gccaagtggtcccaggctgcacccatggcagaaggagagcataaaacccatgaagtggtg
aagttcatggacgtctaccagcgcagctactgccgtccaatcgagaccctggtggacatc
ttccaggagtaccccgatgagatcgagtacatcttcaagccatcctgtgtgcccctgatg
cggtgtgggggctgctgcaacgacgagggcctagagtgcgtgcccactgcggagttcaac
atcaccatgcagattatgcggatcaaacctcaccaaagccaacacataggagagatgagt
ttcctacagcatagcaaatgtgaatgcagaccaaagaaagataaagcaaggcaagaaaat
ccctgtgggccttgctcagagcggagaaagcatttgtttgtacaagatccgcagacgtgt
aaatgttcctgcaaaaacacagactcgcgttgcaaggcgaggcagcttgagttaaacgaa
cgtacttgcagatgtgacaagccgaggcggtga

DBGET integrated database retrieval system