KEGG   Equus caballus (horse): 100033860Help
Entry
100033860         CDS       T01058                                 

Gene name
TGFBR2
Definition
(RefSeq) TGF-beta receptor type-2
  KO
K04388  TGF-beta receptor type-2 [EC:2.7.11.30]
Organism
ecb  Equus caballus (horse)
Pathway
ecb04010  MAPK signaling pathway
ecb04060  Cytokine-cytokine receptor interaction
ecb04068  FoxO signaling pathway
ecb04144  Endocytosis
ecb04218  Cellular senescence
ecb04350  TGF-beta signaling pathway
ecb04380  Osteoclast differentiation
ecb04390  Hippo signaling pathway
ecb04520  Adherens junction
ecb04659  Th17 cell differentiation
ecb04926  Relaxin signaling pathway
ecb04933  AGE-RAGE signaling pathway in diabetic complications
ecb05142  Chagas disease (American trypanosomiasis)
ecb05166  HTLV-I infection
ecb05200  Pathways in cancer
ecb05202  Transcriptional misregulation in cancer
ecb05210  Colorectal cancer
ecb05212  Pancreatic cancer
ecb05220  Chronic myeloid leukemia
ecb05225  Hepatocellular carcinoma
ecb05226  Gastric cancer
Module
ecb_M00680  TGF-beta signaling
Brite
KEGG Orthology (KO) [BR:ecb00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    100033860 (TGFBR2)
   04350 TGF-beta signaling pathway
    100033860 (TGFBR2)
   04390 Hippo signaling pathway
    100033860 (TGFBR2)
   04068 FoxO signaling pathway
    100033860 (TGFBR2)
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100033860 (TGFBR2)
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    100033860 (TGFBR2)
  Cell growth and death
   04218 Cellular senescence
    100033860 (TGFBR2)
  Cellular community - eukaryotes
   04520 Adherens junction
    100033860 (TGFBR2)
 Organismal Systems
  Immune system
   04659 Th17 cell differentiation
    100033860 (TGFBR2)
  Endocrine system
   04926 Relaxin signaling pathway
    100033860 (TGFBR2)
  Development
   04380 Osteoclast differentiation
    100033860 (TGFBR2)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    100033860 (TGFBR2)
   05202 Transcriptional misregulation in cancers
    100033860 (TGFBR2)
   05210 Colorectal cancer
    100033860 (TGFBR2)
   05212 Pancreatic cancer
    100033860 (TGFBR2)
   05225 Hepatocellular carcinoma
    100033860 (TGFBR2)
   05226 Gastric cancer
    100033860 (TGFBR2)
   05220 Chronic myeloid leukemia
    100033860 (TGFBR2)
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    100033860 (TGFBR2)
  Infectious diseases
   05166 HTLV-I infection
    100033860 (TGFBR2)
   05142 Chagas disease (American trypanosomiasis)
    100033860 (TGFBR2)
Enzymes [BR:ecb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     100033860 (TGFBR2)
Protein kinases [BR:ecb01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR2 family [OT]
   100033860 (TGFBR2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ecTbetaR2 Pkinase_Tyr Pkinase Haspin_kinase APH
Motif
Other DBs
NCBI-GeneID: 100033860
NCBI-ProteinID: NP_001288076
Ensembl: ENSECAG00000015269
VGNC: 24056
Position
16
AA seq 531 aa AA seqDB search
MVTDNDGAVKFPQFCKFCNVSSSICDNQKSCMSNCSITSRCEKPREVCVAVWRKNDKNIT
LETVCHDPKLTYHGFVLEDAASPKCIMKEKKVSGETFFMCSCSSDECNDHIIFSEEYATN
NPDLLLVIFQVTGVSLLPPLGIAIAVIITFYCYRVHRQQKLSPSWETSKPRKLMEFSEHL
AIILEDDRSDISSTCANNINHNTELLPIELDTLVGKGRFAEVYKAKLKQNTSEQFETVAV
KIFPYEEYASWKTEKDIFSDINLKHENILQFLTAEERKTELGKQYWLITAFHAKGNLQEY
LTRHVISWEDLRKLGSSLARGIAHLHSDHTLCGRPKMPIVHRDLKSSNILVKNDLTCCLC
DFGLSLRLDPTLSVDDLANSGQVGTARYMAPEVLESRMNLENVESFKQTDVYSMALVLWE
MTSRCNAVGEVKDYEPPFGSKVREHPCVESMKDNVLRDRGRPEIPSSWLNHQGIQMVCET
LTECWDHDPEARLTAQCVAERFSELEHMDRLSGRSCSEEKIPEDGSLNTTK
NT seq 1596 nt NT seq  +upstreamnt  +downstreamnt
atggtcactgacaacgacggtgcagtcaagtttccacaattttgtaaattttgcaacgtg
agctcttccatctgtgacaaccagaaatcctgcatgagcaactgcagcatcacgtccaga
tgtgagaagccacgcgaagtctgtgtggctgtctggagaaagaatgataagaacataaca
ctagagacggtttgccatgaccccaagctcacctaccatggatttgttcttgaagatgct
gcttctccaaagtgtattatgaaggaaaaaaaagtgtctggcgagactttctttatgtgt
tcctgtagctctgatgagtgcaacgaccacatcatcttctcagaagaatatgccaccaac
aaccctgacttgttgttagtcatattccaagtgacaggcgtcagcctcctgccaccgctg
ggaattgccattgcggtcatcatcaccttctactgctaccgcgttcaccggcagcagaag
ctgagcccgtcctgggagaccagcaagccacggaagctcatggagttcagcgagcacctt
gccatcattctggaagacgaccgctccgacatcagctctacgtgtgccaacaatatcaac
cacaacacagagctgctgcccattgagctggacaccctggtggggaaaggtcgctttgct
gaggtctacaaggccaagctgaagcagaacacttcagagcagtttgagaccgtggcagtc
aagatctttccttatgaggagtacgcctcctggaagacagagaaggacattttttcagac
atcaacctgaagcatgagaacatactccagttcctgacagctgaggagcgaaagacagaa
ctgggaaagcaatattggctgatcaccgctttccatgccaagggcaacctacaggaatac
cttacacggcatgtcatcagctgggaggacctgcgcaagctaggcagctccctagcccgg
ggcattgctcacctgcacagtgaccacaccctgtgcgggaggcccaagatgcccattgtg
cacagggacctcaagagctccaacatcctcgtgaagaatgacctgacctgctgcctgtgt
gactttgggctttccctgcgtttggacccgaccctgtctgtggatgacctggccaacagt
gggcaggtgggaactgcaagatacatggccccagaagtcctggagtccaggatgaatttg
gagaatgttgagtccttcaagcagacagatgtctactccatggctctggtgctctgggaa
atgacatctcgctgtaacgcagtgggagaagtgaaagattatgagcctccatttggttcc
aaggtgcgggagcatccctgtgtcgaaagcatgaaggacaatgtcttgagagatcgagga
cgaccagaaattcccagctcctggctcaaccaccagggcatccagatggtgtgtgagact
ctgaccgagtgctgggaccacgacccggaggcccgtctcacggcccagtgcgtggcggaa
cgcttcagcgagctggagcacatggacagactctcggggaggagctgctccgaggagaag
attcccgaagacggctcgctgaacactaccaaatag

DBGET integrated database retrieval system