KEGG   Equus caballus (horse): 100033875
Entry
100033875         CDS       T01058                                 

Gene name
EDNRB
Definition
(RefSeq) endothelin receptor type B precursor
  KO
K04198  endothelin receptor type B
Organism
ecb  Equus caballus (horse)
Pathway
ecb04020  Calcium signaling pathway
ecb04022  cGMP-PKG signaling pathway
ecb04080  Neuroactive ligand-receptor interaction
ecb04916  Melanogenesis
ecb04926  Relaxin signaling pathway
ecb05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    100033875 (EDNRB)
   04022 cGMP-PKG signaling pathway
    100033875 (EDNRB)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100033875 (EDNRB)
 09150 Organismal Systems
  09152 Endocrine system
   04926 Relaxin signaling pathway
    100033875 (EDNRB)
   04916 Melanogenesis
    100033875 (EDNRB)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100033875 (EDNRB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:ecb04030]
    100033875 (EDNRB)
G protein-coupled receptors [BR:ecb04030]
 Rhodopsin family
  Peptide
   Endothelin
    100033875 (EDNRB)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx 7TM_GPCR_Srw 7tm_4 DUF2070
Other DBs
NCBI-GeneID: 100033875
NCBI-ProteinID: NP_001075306
Ensembl: ENSECAG00000024851
VGNC: 17425
UniProt: O62709 F6PYK5
Position
17
AA seq 443 aa
MQPLPTLCGRVLVALILACGVAGVQGEERRFPPARATPPLLGSEEIMTPPTKTSWPTGSN
ASVPRSSAPPQMPKAGRTAGAQRRTLPPPPCERTIEIKETFKYINTVVSCLVFVLGIIGN
STLLRIIYKNKCMRNGPNILIASLALGDLLHIIIDIPINVYKLLAEDWPFGVEMCKLVPF
IQKASVGITVLSLCALSIDRYRAVASWSRIKGIGVPKWTAVEIVLIWVVSVVLAVPEAVG
FDMITADYKGSYLRICLLHPTQKTAFMQFYKNAKDWWLFSFYFCLPLAITAFFYTLMTCE
MLRKKSGMQIALNDHLKQRREVAKTVFCLVLVFALCWLPLHLSRILKHTLYDQNDPHRCE
LLSFLLVLDYIGINMASLNSCINPIALYLVSKRFKNCFKSCLCCWCQSFEEKQSLEDKQS
CLKFKANDHGYDNFRSSNKYSSS
NT seq 1332 nt   +upstreamnt  +downstreamnt
atgcagcctctgccaaccctgtgtggacgcgttctggtggcgctgatccttgcctgcggc
gtggcaggggtccagggagaagagaggagattcccgccggccagggccactccgccactt
ctggggtctgaagagataatgacgcccccgactaagacctcctggccgacggggtccaac
gccagcgtgccgcggtcatcagcacctccgcaaatgcctaaagcagggaggacggcggga
gcccagcgacgcaccctccctcctcccccgtgcgaaagaaccatcgagatcaaggagact
ttcaagtacatcaacacagtagtgtcctgcctagtgttcgtgctgggcatcatcggaaac
tccacactgctgagaatcatttacaagaacaagtgcatgcggaacggccctaatatcttg
atcgccagcctggctctgggagacttgctgcacatcatcattgacatccccatcaatgtc
tacaagctgctggcggaggactggccctttggagtcgagatgtgtaagctggtgcctttc
atacagaaggcctccgtgggcatcactgtgctgagtctgtgtgctctaagtattgacaga
tatcgagctgttgcttcttggagtcgaattaaaggaatcggggttccaaaatggacagca
gtagaaattgttttaatttgggtggtctctgtggttctggctgtccctgaagccgtgggt
tttgatatgattaccgctgactacaaaggaagttatctgcgaatctgcctgcttcatccc
actcagaaaacagccttcatgcagttttacaagaatgctaaggattggtggctatttagt
ttctatttctgcttgccattggccatcactgcatttttttataccttgatgacctgtgaa
atgttgagaaagaagagtggcatgcaaattgctttaaatgatcacttaaagcagagaagg
gaagtggcgaaaacagtattctgcctggtccttgtctttgccctgtgctggcttcctctt
cacctcagcaggattttgaaacacactctttatgatcagaatgatccccatagatgtgaa
cttttgagctttttgttggtattggactacattggcatcaacatggcctccctgaattcc
tgcattaatccaatagctctgtatttggtgagcaaaagattcaaaaactgctttaagtcg
tgcttatgctgctggtgccaatcatttgaagaaaaacagtccttggaagacaagcagtca
tgcttaaagttcaaagctaatgatcacggatatgacaacttccgttccagtaataaatac
agctcatcttga

DBGET integrated database retrieval system