KEGG   Equus caballus (horse): 100034023
Entry
100034023         CDS       T01058                                 

Gene name
KLK1E2
Definition
(RefSeq) kallikrein-1E2 precursor
  KO
K01325  tissue kallikrein [EC:3.4.21.35]
Organism
ecb  Equus caballus (horse)
Pathway
ecb04614  Renin-angiotensin system
ecb04961  Endocrine and other factor-regulated calcium reabsorption
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09150 Organismal Systems
  09152 Endocrine system
   04614 Renin-angiotensin system
    100034023 (KLK1E2)
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    100034023 (KLK1E2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:ecb01002]
    100034023 (KLK1E2)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ecb04147]
    100034023 (KLK1E2)
Enzymes [BR:ecb01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.35  tissue kallikrein
     100034023 (KLK1E2)
Peptidases and inhibitors [BR:ecb01002]
 Serine peptidases
  Family S1: chymotrypsin family
   100034023 (KLK1E2)
Exosome [BR:ecb04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100034023 (KLK1E2)
SSDB
Motif
Pfam: Trypsin Trypsin_2 DUF1986 DUF316
Other DBs
NCBI-GeneID: 100034023
NCBI-ProteinID: NP_001075362
Ensembl: ENSECAG00000011643
UniProt: Q6H321
Structure
PDB: 
1GVZ

Position
10
AA seq 261 aa
MWFLVLCLDLSLGETGALPPIQSRIIGGWECEKHSKPWQVAVYHQGHFQCGGVLVHPQWV
LTAAHCMSDDYQIWLGRHNLSEDEDTAQFHQVSDSFLDPQFDLSLLKKKYLRPYDDISHD
LMLLRLAQPARITDAVKILDLPTQEPKLGSTCYTSGWGLISTFTNRGSGTLQCVELRLQS
NEKCARAYPEKMTEFVLCATHRDDSGSICLGDSGGALICDGVFQGITSWGYSECADFNDN
FVFTKVMPHLKWIKETIEKNS
NT seq 786 nt   +upstreamnt  +downstreamnt
atgtggttcctggttctgtgcctcgacttatccctgggcgagactggcgccctgcccccc
atccagtcccggatcataggaggctgggagtgtgagaagcattccaaaccctggcaggtg
gctgtgtatcatcaagggcacttccagtgtgggggcgttctggtgcacccccagtgggtg
ctcacagccgctcactgcatgagtgacgattaccagatctggctggggcgccacaatctg
tctgaggatgaagacacagcccagttccaccaggtcagtgacagcttcctagatccacaa
ttcgacctgagcctcctgaagaagaaatacctgcgcccttatgatgacatcagccacgac
ctcatgctgctccgcctggctcagcccgcccggataacagacgctgtgaagatcctggac
ctgcccacccaggaacccaaactgggaagcacctgctacacctcgggctggggcctgatc
agcacgtttacaaacagagggtcaggcacactccagtgtgtggaactccgactccagtct
aatgagaagtgtgcccgagcctacccagagaagatgaccgagttcgtgctgtgcgctacc
cacagggatgatagcggaagcatctgcctgggtgactcagggggcgcgctgatctgcgac
ggtgtgtttcaaggaatcacgtcatggggctacagcgagtgtgccgacttcaacgacaac
tttgtcttcaccaaggtgatgccccatctgaagtggatcaaggagaccatagagaaaaac
agctga

DBGET integrated database retrieval system