KEGG   Equus caballus (horse): 100034065
Entry
100034065         CDS       T01058                                 

Symbol
TNNI3
Name
(RefSeq) troponin I, cardiac muscle
  KO
K12044  troponin I, cardiac muscle
Organism
ecb  Equus caballus (horse)
Pathway
ecb04024  cAMP signaling pathway
ecb04260  Cardiac muscle contraction
ecb04261  Adrenergic signaling in cardiomyocytes
ecb05410  Hypertrophic cardiomyopathy
ecb05414  Dilated cardiomyopathy
ecb05415  Diabetic cardiomyopathy
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    100034065 (TNNI3)
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    100034065 (TNNI3)
   04261 Adrenergic signaling in cardiomyocytes
    100034065 (TNNI3)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    100034065 (TNNI3)
   05414 Dilated cardiomyopathy
    100034065 (TNNI3)
   05415 Diabetic cardiomyopathy
    100034065 (TNNI3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:ecb04812]
    100034065 (TNNI3)
Cytoskeleton proteins [BR:ecb04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Troponins
     100034065 (TNNI3)
SSDB
Motif
Pfam: Troponin Troponin-I_N DUF919 Tup_N DUF3738
Other DBs
NCBI-GeneID: 100034065
NCBI-ProteinID: NP_001075373
Ensembl: ENSECAG00000017232
VGNC: 24391
UniProt: Q5PYI0
Position
10:complement(24804103..24807634)
AA seq 205 aa
MADQSGNAAPPPVRRRSSANYRAYATEPHAKKKSKISASRKLQLKTLMLQIAKQELEREA
VERRGEKGRALSTRCQPLELAGLGFEELQDLCRQLHARVDKVDEERYDVEAKVTKNITEI
ADLNQKIFDLRGKFKRPTLRRVRISADAMMQALLGTRAKETLDLRAHLKQVKKEDTEKEN
REVGDWRKNIDALSGMEGRKKKFEG
NT seq 618 nt   +upstreamnt  +downstreamnt
atggcggaccagagcggcaatgcggccccgcccccggtccgacgccgctcctcggccaac
taccgcgcctacgccaccgagccgcacgccaagaaaaagtctaagatctccgcctcaaga
aagctgcagctgaagaccctgatgctgcagattgcgaagcaggagctggagcgggaggcg
gtggagcggcgcggagagaaggggcgcgctttgagcacgcgatgccagcctttggagctg
gctgggctgggcttcgaggagctgcaggacttgtgccgacagctccatgcccgtgtggac
aaggtggatgaggagagatacgatgtggaggcgaaagtcaccaagaacatcacggagatt
gcagatctgaatcagaagatctttgaccttcggggcaagtttaagcggcccaccctgcgg
agggtgcggatctctgcggatgccatgatgcaggcactgctggggaccagggctaaggag
accttagaccttcgggcccacctcaagcaggtgaagaaggaagacaccgagaaggaaaac
cgggaggtgggagactggcgtaagaacatcgacgcgctcagtggaatggagggccgcaag
aaaaagtttgagggctga

DBGET integrated database retrieval system