KEGG   Equus caballus (horse): 100034169Help
Entry
100034169         CDS       T01058                                 

Gene name
IL7R
Definition
(RefSeq) interleukin-7 receptor subunit alpha precursor
  KO
K05072  interleukin 7 receptor
Organism
ecb  Equus caballus (horse)
Pathway
ecb04060  Cytokine-cytokine receptor interaction
ecb04068  FoxO signaling pathway
ecb04151  PI3K-Akt signaling pathway
ecb04630  Jak-STAT signaling pathway
ecb04640  Hematopoietic cell lineage
ecb05200  Pathways in cancer
ecb05340  Primary immunodeficiency
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    100034169 (IL7R)
   04068 FoxO signaling pathway
    100034169 (IL7R)
   04151 PI3K-Akt signaling pathway
    100034169 (IL7R)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100034169 (IL7R)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    100034169 (IL7R)
 09160 Human Diseases
  09161 Cancers: Overview
   05200 Pathways in cancer
    100034169 (IL7R)
  09163 Immune diseases
   05340 Primary immunodeficiency
    100034169 (IL7R)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:ecb04050]
    100034169 (IL7R)
   04090 CD molecules [BR:ecb04090]
    100034169 (IL7R)
Cytokine receptors [BR:ecb04050]
 Interleukin receptor families
  IL2 receptor family
   100034169 (IL7R)
CD molecules [BR:ecb04090]
 Proteins
  100034169 (IL7R)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FN3_7 fn3
Motif
Other DBs
NCBI-GeneID: 100034169
NCBI-ProteinID: NP_001075411
Ensembl: ENSECAG00000010973
VGNC: 19038
UniProt: A0MSX9
Position
21
AA seq 458 aa AA seqDB search
MTILGTTFGMVFYLLQVVSGESGYAQNGDFEDAELDDYSFSCYSQLEVDGPQHLLSCAFE
DPDVNSTNLEFEICEGLLEVKCLNFSKLQETYFIKTKKFLLIGDSTICVKLGGKHITCQK
LNIVKRVKPEAPFDVKVIYREEANEFVVTFNTSHLQKKYVKDLLHEVVYRLEKNENDWMH
VNISSTKLTLLQRKLQPNAMYEIKVRSIPNTNYFEGFWSEWSPSSHFRTPENNSGKMDPV
LLIISIVSFFSVALMVILACVLWKKRIKPIVWPSLPDHKKTLEQLCKKPKKNLNVSFNPE
SFLDCQIHKVDGIQARDEAEAFLQDTFPPQLDDSEKQRLGGGVQGLNWPSQHAVITPKTF
GGESPLRCLSGSVTVCDVPVIPSSRPPDCREGGKNGPHVYQGLLLGAGTTNSTLPHLFPF
QSGILTLNPAVQGQPLFTSLGSSQEEAYVTMSSFYQNQ
NT seq 1377 nt NT seq  +upstreamnt  +downstreamnt
atgacaattctaggtacaacttttggtatggttttctatttacttcaagtcgtttctgga
gaaagtggctatgcacagaatggagactttgaagacgcagaactcgacgactactctttc
tcgtgctacagccagttggaagtggatggaccccagcacttgctgagctgtgcttttgag
gacccagatgtcaacagcaccaatctggaatttgaaatatgtgagggccttttggaggta
aagtgcctgaattttagtaaattgcaagagacgtatttcatcaagacaaagaaattctta
ctgattggagacagcacaatctgtgtgaagctcggaggaaagcacataacttgccaaaaa
ctgaacatagtcaagagagttaaacctgaggccccttttgacgtaaaagtcatctatcgt
gaggaagcaaatgagtttgtggtgacatttaatacatcgcacttgcaaaagaagtatgtg
aaggatttattgcatgaagtggtctaccgcctggaaaaaaatgaaaatgattggatgcac
gtgaatatatccagtacaaagctgacactcctacagagaaagctacaacctaatgcaatg
tatgagattaaagtgcgatccatccctaataccaactactttgaaggcttttggagtgaa
tggagtccaagttcccacttcagaactccagagaacaacagcgggaagatggatcctgtt
ttactaattatcagcattgtgagtttcttctctgtggctctgatggtcattttggcttgt
gtgttatggaaaaaaagaattaagcctattgtatggcctagtctccctgaccataagaag
actctggaacaactgtgcaagaaaccaaaaaagaatttgaatgtgagtttcaatcctgaa
agtttcctggactgtcagattcataaggtggatggcattcaagctagagatgaagcagaa
gccttcctgcaagatacttttcctccgcaactagatgattcagagaagcagaggcttgga
gggggtgtgcagggcctcaactggccatcccagcatgcagtcattaccccaaaaactttc
ggaggagagtcacccctcagatgtctgtctgggagtgtcactgtatgtgatgtccctgta
atcccctcctccaggcccccagactgcagagaaggaggcaagaatgggcctcatgtgtac
cagggcctgctgcttggtgctggaactacaaacagcaccctgccccatttgtttcctttc
caatcgggaatcctgacattgaaccctgcggttcagggacagcctctcttcacttccctg
ggatccagtcaagaagaagcatatgtcaccatgtccagcttctaccaaaaccagtga

DBGET integrated database retrieval system