KEGG   Equus caballus (horse): 100034195Help
Entry
100034195         CDS       T01058                                 

Gene name
MMP3
Definition
(RefSeq) stromelysin-1 precursor
  KO
K01394  matrix metalloproteinase-3 (stromelysin 1, progelatinase) [EC:3.4.24.17]
Organism
ecb  Equus caballus (horse)
Pathway
ecb04657  IL-17 signaling pathway
ecb04668  TNF signaling pathway
ecb05202  Transcriptional misregulation in cancer
ecb05215  Prostate cancer
ecb05323  Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    100034195 (MMP3)
 09150 Organismal Systems
  09151 Immune system
   04657 IL-17 signaling pathway
    100034195 (MMP3)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    100034195 (MMP3)
  09162 Cancer: specific types
   05215 Prostate cancer
    100034195 (MMP3)
  09163 Immune disease
   05323 Rheumatoid arthritis
    100034195 (MMP3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:ecb01002]
    100034195 (MMP3)
Enzymes [BR:ecb01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.17  stromelysin 1
     100034195 (MMP3)
Peptidases [BR:ecb01002]
 Metallo Peptidases
  Family M10
   100034195 (MMP3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M10 Hemopexin PG_binding_1 Astacin Reprolysin_3 Reprolysin_4 Reprolysin_5 DUF4953
Motif
Other DBs
NCBI-GeneID: 100034195
NCBI-ProteinID: NP_001075964
Ensembl: ENSECAG00000000750
UniProt: Q28397
Position
7
AA seq 477 aa AA seqDB search
MKNLPILLLLCVAACSAYPLDRSARDEDSNMDLLQDYLEKYYDLGKEMRQYVRRKDSGPI
VKKIQEMQKFLGLKVTGKLDSDTVEVMHKSRCGVPDVGHFTTFPGMPKWSKTHLTYRIVN
YTQDLPRDAVDSDVEKALKIWEEVTPLTFSRIYEGEADIMITFAVREHGDFFPFDGPGKV
LAHAYPPGPGMNGDAHFDDDEHWTKDASGINFLLVAAHELGHSLGLYHSTNTEALMYPLY
NTLKGPARVRLSQDDVTGIQSLYGPPPASPDSPVEPSEPEPPAPGTLAMCDPALSFDAIS
TLRGEILFFKDRYFWRKTFRTLVPEFHPISSFWPSLPSGIDAAYEVTSRDSVFIFKGNKF
WAIRGNEEQAGYPRGIHTLGFPPTVRKIDAAIFDKEKQKTYFFVEDKYWRFDEKRQSMEP
GYPKQIAEDFPGIDSKLDAAFESFGFFYFFSGSSQFEFDPNAKKVTHVLKSNSWFNC
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atgaagaatcttccaattctgctgttactatgcgtggcagcgtgctcagcctatccgttg
gacagatctgcaagggacgaggatagcaacatggaccttcttcaggactacctagaaaaa
tactacgaccttggaaaagaaatgagacaatatgttagaagaaaggacagtggtcctatt
gttaaaaaaattcaagaaatgcagaagttcctggggttgaaggtgacaggaaagctggac
tctgacactgtggaggtgatgcacaaatccagatgcggagttcctgatgtcggtcacttc
actacatttcctggcatgccaaagtggagcaaaactcaccttacttacaggattgtgaat
tatacacaggatttgccaagagatgctgttgattctgacgttgagaaagctctgaaaatc
tgggaggaggtgactccacttacattctccaggatttatgaaggagaggctgacataatg
atcacttttgcagttcgagaacatggagatttttttccttttgatggacctggaaaagtt
ttggctcatgcctatccacctgggccagggatgaatggagatgctcattttgatgatgat
gaacactggacgaaggatgcatcagggatcaattttctccttgttgctgctcatgaactt
ggtcattccctgggtctctatcactcgaccaacaccgaagctttgatgtacccactctac
aatacactcaaaggcccggcccgggtccgcctttctcaagatgatgtgactggcattcaa
tccctctatggacctccccctgcctctcctgatagccccgtggagcccagtgaacctgag
cctcccgcccctggaacactagccatgtgcgatcctgctttgtcctttgatgcaatcagc
actctgagaggagaaattctgttctttaaagacagatatttttggcgcaaaaccttcagg
acacttgtccctgaatttcatccgatctcttcgttttggccatctcttccttcaggcata
gatgctgcatatgaagtgactagcagagacagtgttttcatttttaaaggaaataagttc
tgggccatcagaggaaatgaggaacaagcgggttacccgagaggcatccacactctgggt
ttccctccaacagtaaggaaaatagacgcagccatttttgataaggaaaagcagaaaaca
tacttctttgtagaggacaaatactggagatttgatgagaagagacaatctatggagcca
ggctatcccaagcaaatagcagaagactttccagggattgactcaaagcttgatgctgct
tttgaatcatttgggtttttctatttcttcagtggatcttcacagtttgaatttgaccca
aatgcaaagaaagtgacacatgttctcaagagtaatagctggtttaattgttag

DBGET integrated database retrieval system