KEGG   Equus caballus (horse): 100034242Help
Entry
100034242         CDS       T01058                                 

Definition
(RefSeq) alcohol dehydrogenase E chain
  KO
K13951  alcohol dehydrogenase 1/7 [EC:1.1.1.1]
Organism
ecb  Equus caballus (horse)
Pathway
ecb00010  Glycolysis / Gluconeogenesis
ecb00071  Fatty acid degradation
ecb00350  Tyrosine metabolism
ecb00830  Retinol metabolism
ecb00980  Metabolism of xenobiotics by cytochrome P450
ecb00982  Drug metabolism - cytochrome P450
ecb01100  Metabolic pathways
ecb05204  Chemical carcinogenesis
Brite
KEGG Orthology (KO) [BR:ecb00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100034242
  Lipid metabolism
   00071 Fatty acid degradation
    100034242
  Amino acid metabolism
   00350 Tyrosine metabolism
    100034242
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    100034242
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    100034242
   00982 Drug metabolism - cytochrome P450
    100034242
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    100034242
Enzymes [BR:ecb01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     100034242
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADH_zinc_N ADH_N Glu_dehyd_C ADH_zinc_N_2 UDPG_MGDP_dh_N 2-Hacid_dh_C
Motif
Other DBs
NCBI-GeneID: 100034242
NCBI-ProteinID: NP_001075997
UniProt: P00327
Structure
PDB: 

Position
3
AA seq 375 aa AA seqDB search
MSTAGKVIKCKAAVLWEEKKPFSIEEVEVAPPKAHEVRIKMVATGICRSDDHVVSGTLVT
PLPVIAGHEAAGIVESIGEGVTTVRPGDKVIPLFTPQCGKCRVCKHPEGNFCLKNDLSMP
RGTMQDGTSRFTCRGKPIHHFLGTSTFSQYTVVDEISVAKIDAASPLEKVCLIGCGFSTG
YGSAVKVAKVTQGSTCAVFGLGGVGLSVIMGCKAAGAARIIGVDINKDKFAKAKEVGATE
CVNPQDYKKPIQEVLTEMSNGGVDFSFEVIGRLDTMVTALSCCQEAYGVSVIVGVPPDSQ
NLSMNPMLLLSGRTWKGAIFGGFKSKDSVPKLVADFMAKKFALDPLITHVLPFEKINEGF
DLLRSGESIRTILTF
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atgagcacagcaggaaaagtaataaaatgcaaagcggctgtgctgtgggaggaaaagaaa
ccattttccatcgaggaggtggaggttgcacccccgaaggcccatgaagtccgtataaag
atggtggccacaggaatttgtcgctcagatgaccacgtggttagtggaacccttgtcaca
cctcttcctgtgatcgcaggccatgaggcagcgggcattgtggagagcattggagaaggc
gtcactacagtaagaccaggtgataaagtcatcccactctttactccccagtgtggaaaa
tgcagggtttgtaagcaccctgaaggcaacttctgcttgaaaaatgatctgagcatgcct
cggggaaccatgcaggatggtaccagcaggttcacctgcagagggaagcccatccaccac
ttccttggcaccagcaccttctcccagtacaccgtggtggacgagatctcagtggccaag
atcgatgcggcctcaccgctggagaaagtctgtctcattggctgtggattttctactggt
tatgggtctgcagtcaaggttgccaaggtcacccagggctccacctgtgccgtgtttggc
cttggaggagtgggcctgtctgttatcatgggctgtaaagcagccggagcggccaggatc
attggggtggacatcaacaaagacaagtttgcaaaggccaaagaagtgggtgccactgag
tgtgtcaaccctcaggactacaagaaacccatccaggaggtgctgacagaaatgagcaat
ggaggtgtggatttttcctttgaagtcattggtcggctcgacactatggtgactgccttg
tcatgctgtcaagaagcatatggtgtgagcgtcattgtgggagtacctcctgattcccaa
aatctctctatgaatcctatgttgctactgagtggacgtacctggaaaggagctattttt
ggcggttttaagagtaaagattctgtccccaaacttgtggccgattttatggctaaaaag
tttgcactggatcctttaatcacccatgttttaccttttgaaaaaataaatgaaggattt
gacctgcttcgctctggagagagtatccgtaccatcctgacgttttga

DBGET integrated database retrieval system