KEGG   Equus caballus (horse): 100049918Help
Entry
100049918         CDS       T01058                                 

Gene name
GRM3
Definition
(RefSeq) metabotropic glutamate receptor 3
  KO
K04606  metabotropic glutamate receptor 3
Organism
ecb  Equus caballus (horse)
Pathway
ecb04072  Phospholipase D signaling pathway
ecb04080  Neuroactive ligand-receptor interaction
ecb04724  Glutamatergic synapse
ecb05030  Cocaine addiction
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04072 Phospholipase D signaling pathway
    100049918 (GRM3)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100049918 (GRM3)
 09150 Organismal Systems
  09156 Nervous system
   04724 Glutamatergic synapse
    100049918 (GRM3)
 09160 Human Diseases
  09165 Substance dependence
   05030 Cocaine addiction
    100049918 (GRM3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:ecb04030]
    100049918 (GRM3)
G protein-coupled receptors [BR:ecb04030]
 Metabotropic glutamate receptor family
  Glutamate (metabotropic)
   100049918 (GRM3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ANF_receptor 7tm_3 NCD3G Peripla_BP_6
Motif
Other DBs
NCBI-GeneID: 100049918
NCBI-ProteinID: XP_014594685
Ensembl: ENSECAG00000008595
VGNC: 18601
UniProt: F6T9I4
Position
4
AA seq 879 aa AA seqDB search
MKMLTRLQVLTLALFSKGFLLSLADHNFLRREIKIEGDLVLGGLFPINEKGTGTEECGRI
NEDRGIQRLEAMLFAIDEINKDNYLLPGVKLGVHILDTCSRDTYALEQSLEFVRASLTKV
DEAEYMCPDGSYAIQENIPLLIAGVIGGSYSSVSIQVANLLRLFQIPQISYASTSAKLSD
KSRYDYFARTVPPDFYQAKAMAEILRFFNWTYVSTVASEGDYGETGIEAFEQEARQRNIC
IATAEKVGRSNIRKSYDSVIRELLQKPNARVVVLFMRSDDSRELIAAASRANASFTWVAS
DGWGAQESIIKGSEHVAYGAITLELASQPVRQFDRYFQSLNPYNNHRNPWFQDFWEQKFQ
CSLQNKRNHRRACDKHLAIDSNNYEQESKIMFVVNAVYAMAHALHKMQRTLCPNTTKLCD
AMKIVDGKKLYRDYLLKINFTAPFIPNKGADSIVKFDTFGDGMGRYNVFNFQYVGGKYSY
LKVGHWAETLSLDVDSIHWSRNSIPTSQCSDPCAPNEMKNMQPGDVCCWICIPCEPYEYL
ADEFTCMDCGLGQWPTADLSGCFDLPEDYIKWEDAWAIGPVTIACLGFLCTCMVVTVFIK
HNNTPLVKASGRELCYILLFGVGLSYCMTFFFIAKPSPVICTLRRLGLGTSFAVCYSALL
TKTNCIARIFDGVKNGAQRPKFISPSSQVFICLGLILVQIVVVSVWLILEVPGTRRYTLP
EKRETVILKCNVKDSSMLISLTYDVILVILCTVYAFKTRKCPENFNEAKFIGFTMYTTCI
IWLAFLPIFYVTSSDYRVQTTTMCISVSLSGFVVLGCLFAPKVHIILFQPQKNVVTHRLH
LNRFSVSGTGTTYSQSSASTYVPTVCNGREVLDSTTSSL
NT seq 2640 nt NT seq  +upstreamnt  +downstreamnt
atgaagatgttgacaagactccaagttcttaccttagctttgttttcaaaaggattttta
ctctctttagcggaccataactttctgaggagggagattaaaatagaaggtgaccttgtt
ttagggggcctatttcctattaatgaaaaaggcactggaactgaagaatgtgggcgaatc
aatgaagaccgagggatccaacgcctggaagccatgttatttgctattgatgaaatcaac
aaagacaactacttgctaccaggagtgaagttgggtgttcacattttggatacatgctca
agggacacctatgcattagagcaatcactggaatttgtcagggcgtctttgactaaagtg
gatgaagctgagtatatgtgtcctgatggatcctatgccattcaagaaaacatcccactg
ctcattgcaggggtcattggcggctcttacagcagtgtttccatacaggtggcaaacctg
ctacgcctcttccagatccctcagataagctacgcgtccaccagcgccaaactcagcgac
aagtcacgctatgattactttgccaggacggtgccccctgacttctaccaggccaaagcc
atggccgagatcttgcgtttcttcaactggacctacgtgtccactgtggcctccgagggc
gactatggggagacaggaatcgaggccttcgagcaggaagcccgccagcgcaacatctgc
atcgccacagccgagaaggtaggtcgctccaacatccgcaagtcctatgacagcgtgatc
cgtgagctgctgcagaagcccaacgcgcgagtcgtggtcctcttcatgcgcagtgacgac
tcgcgcgagctcatcgctgcagccagccgagccaacgcctccttcacctgggtggccagc
gacggctggggcgcgcaggagagcatcatcaagggcagcgagcacgtggcctacggcgcc
atcaccctggagctggcctcgcaacctgtccgccaatttgaccgctacttccagagcctc
aacccttacaacaaccaccgcaacccctggttccaggacttctgggagcagaaattccag
tgcagcctccagaacaagcggaaccaccggcgcgcttgcgacaagcacctggctatcgac
agcaacaactatgagcaagaatccaagatcatgtttgtagtgaacgcggtgtatgccatg
gcccacgccctgcacaaaatgcagcgcaccctctgtcccaacaccaccaagctttgcgat
gctatgaagatcgtggatgggaagaagctgtacagggattacttgctgaaaatcaacttc
acagctccattcatcccaaataaaggtgcagatagcattgtcaagtttgacacttttgga
gatggaatgggacgatacaacgtgttcaatttccagtacgtgggtggcaagtattcctac
ctgaaggttggtcactgggcagaaaccttatcactagatgttgattctatccactggtcc
cggaactcaatccccacttcccagtgcagtgacccctgtgcccccaatgaaatgaagaat
atgcaaccaggggatgtctgctgctggatctgcatcccctgcgagccctatgaatacctg
gctgacgagtttacctgtatggattgtggccttgggcagtggcctactgctgacctctct
ggctgctttgaccttcccgaggactacatcaagtgggaagatgcctgggccattggtcca
gtcaccatcgcctgcctgggttttctgtgtacatgcatggttgtgactgtttttatcaag
cacaacaacacacccttggtcaaagcatcaggccgggagctctgctacatcttgttgttt
ggggttggcctgtcatattgcatgacattcttcttcattgccaagccatcaccagtcatc
tgcacattgcgccgactggggctggggacctccttcgctgtctgttactcagccctgctg
accaagacaaactgcatcgcccggatcttcgatggggtaaagaacggcgctcagaggcca
aaattcatcagcccaagttctcaggttttcatctgcctgggtctgatactggtgcaaatt
gtggtggtgtccgtgtggctcatcctggaggttccaggcaccaggcggtacacccttcca
gagaaacgggaaacagttatcttaaaatgcaatgtgaaagattccagcatgttgatctcc
cttacctacgatgtgatcctggtgatcttatgcacagtgtatgccttcaaaacgcggaag
tgcccagaaaatttcaacgaagccaagttcattggttttaccatgtataccacttgcatc
atctggttggccttcctccctatattttatgtgacatcaagtgactacagagtgcagaca
acaaccatgtgcatctctgttagcctgagtggcttcgtggtcctgggctgtttgtttgca
cccaaggtgcacatcatcctgttccaaccccagaagaacgtggtcacacacagactgcac
ctcaacaggttcagtgtcagtggaactgggaccacatattctcagtcctctgcgagcacg
tatgtccccacggtgtgcaatgggcgggaggtcctcgactccaccacctcatctctgtga

DBGET integrated database retrieval system