KEGG   Equus caballus (horse): 100050075
Entry
100050075         CDS       T01058                                 

Gene name
HSD17B12
Definition
(RefSeq) very-long-chain 3-oxoacyl-CoA reductase
  KO
K10251  17beta-estradiol 17-dehydrogenase / very-long-chain 3-oxoacyl-CoA reductase [EC:1.1.1.62 1.1.1.330]
Organism
ecb  Equus caballus (horse)
Pathway
ecb00062  Fatty acid elongation
ecb00140  Steroid hormone biosynthesis
ecb01040  Biosynthesis of unsaturated fatty acids
ecb01100  Metabolic pathways
ecb01212  Fatty acid metabolism
Module
ecb_M00415  Fatty acid elongation in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09100 Metabolism
  09103 Lipid metabolism
   00062 Fatty acid elongation
    100050075 (HSD17B12)
   00140 Steroid hormone biosynthesis
    100050075 (HSD17B12)
   01040 Biosynthesis of unsaturated fatty acids
    100050075 (HSD17B12)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:ecb01004]
    100050075 (HSD17B12)
Enzymes [BR:ecb01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.62  17beta-estradiol 17-dehydrogenase
     100050075 (HSD17B12)
    1.1.1.330  very-long-chain 3-oxoacyl-CoA reductase
     100050075 (HSD17B12)
Lipid biosynthesis proteins [BR:ecb01004]
 Fatty acid synthase
  Component type
   100050075 (HSD17B12)
SSDB
Motif
Pfam: adh_short adh_short_C2 KR Polysacc_synt_2 GDP_Man_Dehyd Epimerase Sacchrp_dh_NADP TrkA_N 3HCDH_N Pyr_redox Phage_int_SAM_3 NAD_binding_10
Other DBs
NCBI-GeneID: 100050075
NCBI-ProteinID: XP_001488432
Ensembl: ENSECAG00000010538
VGNC: 18884
UniProt: F6Q4Z8
Position
12
AA seq 312 aa
MESALPAAGFLYWVGAGTVAYLALRVSCSLFTALRVWGLGHEAGVGTGLGEWAVVTGGTD
GIGKSYAEELAKRGMKIVLISRSQDKLDQVSSEIREKFKVETRTIAVDFASGDIYDKIET
DLAGLNIGVLVNNVGISYEYPEYFLDIPDLDNTIKKLININVLSVCKMTRLVLPGMVERS
KGVILNISSASGMHPAPLLTIYSATKAFVDFFSRSLHEEYRSKGIFVQSVLPYFIATKLS
KIRRPTLDKPSPETFVKSAIKTVGLQSRTTGYPIHSLVSSIMSMLPSWMSLKISMNYSKA
TRAHYLKKNKKN
NT seq 939 nt   +upstreamnt  +downstreamnt
atggagagcgctctccctgccgccggcttcctgtactgggtgggcgcgggcaccgtggcc
tacctggccctgcgcgtctcctgctcgctcttcacggcccttcgggtctggggtttgggg
cacgaggcgggggtcggcacggggctcggtgaatgggcagttgtcacaggtggtactgat
ggaattggaaaatcatatgcagaagagttagcaaagcgtggaatgaagatcgtccttatc
agcagatctcaggataagctggaccaggtttccagtgaaataagagaaaaattcaaagtg
gagacaaggaccattgctgttgactttgcttcgggagacatttatgacaaaattgaaaca
gacttggcagggcttaacattggtgttttggtgaacaacgtgggcatctcatacgagtat
cctgaatactttttggacattcctgacctggacaataccatcaagaaactgataaatatt
aatgttctttctgtttgtaagatgacacgactggtgctgcctggcatggtggaaagatct
aaaggagtgattctgaacatctcctccgccagtggcatgcacccagctccactgctgacc
atctactctgcaaccaaggcttttgtagatttcttctctcggtccctccatgaggaatac
aggagcaagggcatctttgtgcagagtgttctgccatactttatcgctacgaaactatcg
aaaatccgaaggccgactttggataagccctctccagagacgtttgtgaagtctgcaatt
aaaacggttggcttgcagtcccgaaccaccgggtacccgatccattctctcgtgagctca
ataatgtccatgctgccttcttggatgagtttgaaaatttccatgaattacagcaaggcc
acgcgggctcactatctgaagaaaaacaagaagaactaa

KEGG   Equus caballus (horse): 100070719
Entry
100070719         CDS       T01058                                 

Definition
(RefSeq) very-long-chain 3-oxoacyl-CoA reductase-B-like isoform X1
  KO
K10251  17beta-estradiol 17-dehydrogenase / very-long-chain 3-oxoacyl-CoA reductase [EC:1.1.1.62 1.1.1.330]
Organism
ecb  Equus caballus (horse)
Pathway
ecb00062  Fatty acid elongation
ecb00140  Steroid hormone biosynthesis
ecb01040  Biosynthesis of unsaturated fatty acids
ecb01100  Metabolic pathways
ecb01212  Fatty acid metabolism
Module
ecb_M00415  Fatty acid elongation in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09100 Metabolism
  09103 Lipid metabolism
   00062 Fatty acid elongation
    100070719
   00140 Steroid hormone biosynthesis
    100070719
   01040 Biosynthesis of unsaturated fatty acids
    100070719
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:ecb01004]
    100070719
Enzymes [BR:ecb01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.62  17beta-estradiol 17-dehydrogenase
     100070719
    1.1.1.330  very-long-chain 3-oxoacyl-CoA reductase
     100070719
Lipid biosynthesis proteins [BR:ecb01004]
 Fatty acid synthase
  Component type
   100070719
SSDB
Motif
Pfam: adh_short adh_short_C2 KR Epimerase NAD_binding_10
Other DBs
NCBI-GeneID: 100070719
NCBI-ProteinID: XP_023505657
Position
10
AA seq 311 aa
MESEWDALRALGAVTALWLLLRVTWEVGHLVYVYLLPQARRGAPWLRAHGAWAVVTGATS
GIGKAYAHELARRGLNIVLISRSLSKLDYEAKEIERLHGRITRVIQADFTGGLEIYGAIE
AGLKDLEIGVLVNNVGMLYTPGFKKLLDCDNVAKRLSDVVNCNVMSVVQMTAIVLPQMVA
RGKGIIINISSLSDRRPCPFLAAYAASKAFVRSFSRAVGAEYFSQGVDVQTVSPYTVATN
MTRDVSFGKNAEDFAREALDTLGLTSQTPGCLSHALQSFLLPLLPSWFSLSRWGVKLTSL
WANRLNEKFAN
NT seq 936 nt   +upstreamnt  +downstreamnt
atggagtcggagtgggacgcgctgagggcgctgggggcggttaccgccttgtggctgctg
ctgagggtgacctgggaggtgggccacttagtctatgtctacctgctgccccaggcacgc
cggggcgccccttggctccgggcacatggagcctgggcagtggtgacaggagccaccagc
ggcattggcaaagcctatgcgcacgagctcgccaggagaggtctgaacattgtcctcatc
agtcgaagcctgagcaagttggactacgaggcaaaggagatagagcggcttcatggcagg
atcacacgagtcatccaggccgacttcaccgggggcctggagatctacggcgccatcgag
gcaggactgaaggacctggagatcggagtgttggtgaacaatgtgggcatgctgtataca
cctggcttcaagaaactgctcgactgtgacaatgtcgccaaaagactctcggatgttgta
aactgcaacgtgatgtctgtggtccagatgactgcaattgtcctgccccagatggtcgcc
aggggcaaaggcatcatcatcaacatctcttcgttatctgacaggagaccctgtccattt
ttagcagcatatgcagcctctaaggcctttgtgcgaagcttctcccgggcggtgggcgca
gagtacttctctcagggcgtcgacgtacagacagtgagcccctacacggttgccacaaac
atgacccgtgacgtgagcttcggaaagaatgccgaagactttgctcgggaggcgctggac
actcttggcctcacctcgcaaacgcctgggtgcctgagccacgctttgcagagtttcctg
ctgcctctgctgcccagttggttttctctctcgcgctggggagtgaagttgacatctctg
tgggcgaacaggcttaacgagaagttcgcgaattaa

DBGET integrated database retrieval system