KEGG   Equus caballus (horse): 100050652
Entry
100050652         CDS       T01058                                 

Gene name
AMBRA1
Definition
(RefSeq) activating molecule in BECN1-regulated autophagy protein 1 isoform X5
  KO
K17985  activating molecule in BECN1-regulated autophagy protein 1
Organism
ecb  Equus caballus (horse)
Pathway
ecb04137  Mitophagy - animal
ecb04140  Autophagy - animal
ecb05010  Alzheimer disease
ecb05014  Amyotrophic lateral sclerosis
ecb05016  Huntington disease
ecb05017  Spinocerebellar ataxia
ecb05022  Pathways of neurodegeneration - multiple diseases
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100050652 (AMBRA1)
   04137 Mitophagy - animal
    100050652 (AMBRA1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100050652 (AMBRA1)
   05014 Amyotrophic lateral sclerosis
    100050652 (AMBRA1)
   05016 Huntington disease
    100050652 (AMBRA1)
   05017 Spinocerebellar ataxia
    100050652 (AMBRA1)
   05022 Pathways of neurodegeneration - multiple diseases
    100050652 (AMBRA1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ecb04131]
    100050652 (AMBRA1)
   03029 Mitochondrial biogenesis [BR:ecb03029]
    100050652 (AMBRA1)
Membrane trafficking [BR:ecb04131]
 Autophagy
  Mitophagy
   PINK1-Parkin associated proteins
    100050652 (AMBRA1)
Mitochondrial biogenesis [BR:ecb03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Parkin-dependent mechanism factors
    100050652 (AMBRA1)
SSDB
Motif
Pfam: ANAPC4_WD40 WD40 Spt20 eIF2A Acyl_CoA_thio
Other DBs
NCBI-GeneID: 100050652
NCBI-ProteinID: XP_001489841
Ensembl: ENSECAG00000023789
VGNC: 15273
UniProt: F6Z4X1
Position
12
AA seq 1209 aa
MKVVPEKNAVRILWGRERGTRAFGAQRLLQELVEDKTRWMKWEGKRVELPDSPRSTFLLA
FSPDRTLLASTHVNHNIYITEVKTGKCVHSLIGHRRTPWCVTFHPTISGLIASGCLDGEV
RIWDLHGGSESWFTDSNNAIASLAFHPTAQLLLIATANEIHFWDWSRREPFAVVKTASDM
ERVRLVRFDPLGHYLLTAIVNPSNQQGDDEPEIPIDGTELSHYRQRALLQSQPVRRTPLL
HNFLHMLSSRSSGIQTEPFHPPEQASSTQQDQGLLNRPSAFSTVQSSTAGNTLRNLSLGP
TRRSLGGPLSSHPSRYHREIAPGLTGSEWTRTVLSLNSRCEAESMPPPRTSASSVSLLSV
LRQQEGGSQASVYTSATEGRGFPASGLAAESDGGNGSSQNNSGSIRHELQCDLRRFFLEY
DRLQELDQSLSGEAPQNQQAQEMLNNNIESERPGPSHQPTPHSSENNSNLSRGHLNRCRA
CHNLLTFNNDTLRWERTTPNYSSGEASSSWQVPSTFEGMPSSGSQLPPLERTEGQTPSSS
RLELSSSASPQEERTVGVAFNQETGHWERIYTQSSRSGTVSQEALHQDMPEESSEEDSLR
RRLLESSLISLSRYDGAGSREHPIYPDPARLSPAAYYAQRMIQYLSRRDSIRQRSMRYQQ
NRLRSSTTSSSSDNQGPSVEGTDLEFEDFEDNGDRSRHRAPRNARMSAPSLGRFVPRRFL
LPEYLPYAGIFHERGQPGLATHSSVNRVLAGAVIGDGQSAVASNIANTTYRLQWWDFTKF
DLPEISTASVNVLVQNCKIYNDASCDISADGQLLAAFIPSSQRGFPDEGILAVYSLAPHN
LGEMLYTKRFGPNAISVSLSPMGRYVMVGLASRRILLHPSTEHMVAQVFRLQQAHGGETS
MRRVFNVLYPMPADQRRHVSINSARWLPEPGLGLAYGTNKGDLVICRPEALNSGVEYYWD
QLNETVFTVHSNSRSSERPGTSRATWRTDRDMGLMNAIGLQPRNPTTSVTSQGTQTLALQ
LQNAETQTEREIQEPGTAASGPGEGEGSEYGAGGEDALSRIQRLMAEGGMTAVVQREQST
TMASMGGFGNNIIVSHRIHRSSQTGTEPGAARATSPQPSTSRGLLPEPGQLAERGLSPRT
ASWDQPGTPGREPSQPTLLSSSPVPPPVPLPSTEGPTLHCELTSTRHLPDGGGSSRGEAA
GPSGEPRNR
NT seq 3630 nt   +upstreamnt  +downstreamnt
atgaaggtcgttccagagaagaatgctgtgcggatactctgggggcgagaacggggcact
cgagccttcggagctcagcggcttctgcaggagctggtggaagataaaacccgatggatg
aaatgggagggcaagagggttgaactgccggatagtccgcgctctaccttcttattggcc
ttcagcccagacaggactctcttggcctccacccacgtgaatcataatatctatattacg
gaggtgaagactggcaagtgtgttcattctctgattggacaccgccgcactccatggtgt
gtcacttttcatcccaccatctcaggccttattgcttctggttgcctggatggggaggtt
aggatttgggatttacatggtggcagtgaaagctggttcacagatagcaacaatgccatc
gcctctctggctttccaccctacggctcagctcttgctgattgccactgccaatgagatc
cacttctgggattggagtcgacgggagccctttgctgtggtgaagacagctagtgacatg
gaacgggtccgtctagtaagatttgatcctcttggacactacttactcacagcaattgtt
aacccctctaatcagcagggtgatgatgaaccagagatccccatagatggaacagaatta
tcccactaccgtcagcgtgcccttctgcaatcacagccagttcgccggacgcctctcctc
cacaatttcctgcacatgctgtcctcccgctcctctggcatccagaccgagcccttccat
cccccggagcaggcctcgtcaacgcagcaggaccagggcctcctgaaccggccgtctgcc
ttcagtacagtccagagcagcactgccggcaacacgctccgcaacctcagtctgggtccc
acccgtcgttctttgggaggccctttgtctagccacccttctaggtatcatcgagaaata
gctcccgggctgacaggatctgagtggacccggacagtgctcagtctgaactcccgctgt
gaggcggaatccatgcccccgcccaggaccagtgcctcttcggtgagtttgctgtctgtg
ctgagacagcaggaaggtggctctcaagcatctgtgtacacttcagccacagaagggagg
ggttttccagcgtcagggttggcagctgagtcagatggagggaatggctccagccaaaac
aactcaggcagcattcgccatgagcttcagtgtgacctgagacgcttctttttggagtat
gaccggcttcaggagctggaccagagcctgagtggggaagccccgcagaaccaacaagcc
caggaaatgctcaacaataacattgaatctgagaggccaggcccctcccaccagcccacc
ccacacagcagtgagaacaactccaacctgtcccgtggccacctgaatcgctgccgtgct
tgccacaatctcctgaccttcaacaatgatacactgcgctgggaaagaaccacacctaac
tactcctctggcgaggccagctcctcctggcaggtccccagtacctttgagggcatgccg
tcaagtggcagccagttgccacctctcgagcggactgagggccaaacgcccagctccagc
aggctggagttgagcagctctgctagtccacaggaggagaggactgtgggggtggccttc
aaccaggagacaggccactgggaaagaatttacacccagtccagcagatctggaactgta
tcacaggaggccttacaccaggatatgcctgaagaaagctccgaggaagattcacttcgg
aggaggctgctggagtcttccctcatttcattatcccgttatgatggagcaggatccaga
gagcacccaatttacccagacccagcgagattatctcctgctgcatactacgcccagagg
atgatccagtatctctcacggagagacagtattcgccagcgctccatgcgctaccaacag
aaccgtctccgttcttccaccacctcctcttcctcagacaaccagggtccatcagtagag
ggaaccgacttggagtttgaggactttgaggacaatggtgacagatccaggcaccgagct
ccacgcaatgccaggatgtctgcaccgtcacttggacgctttgtcccgaggcgtttcctg
ctgcctgagtacttgccttatgctgggatttttcatgaacgtggacagcctggcctggct
actcattcttccgttaacagggtcctggcaggggcggtgattggtgatggacagtctgcc
gtggccagtaacattgctaatactacctaccggctccagtggtgggacttcactaagttt
gacctcccagaaatcagtactgcctccgtgaatgtgctggtgcagaactgcaagatctac
aatgatgccagctgtgacatttctgcagatggccagcttctggcagctttcatccctagc
agccaaaggggctttcccgatgaaggcatcctggcagtgtactctctggccccccataac
ctgggtgaaatgctctacaccaagcgatttggtcccaatgccatttccgtgagcctttcc
ccaatgggccgatacgtaatggtgggcttggcctcacgaaggatcctgctgcatccctcc
acagagcacatggtggcccaggtcttcaggctgcaacaggcccatggtggcgagacctcc
atgaggagagttttcaacgtcctttaccccatgcctgctgaccagcggagacatgtcagc
atcaactctgcccgttggctgcccgagccagggctgggcctggcctatggtaccaacaaa
ggagacctggtgatctgccgaccagaggccttaaactctggtgttgagtactactgggac
cagctgaatgagaccgtcttcactgtccactccaacagcaggagcagtgaaaggcctgga
accagcagagccacatggaggacagacagagacatgggtctgatgaatgcgattgggctg
cagccccggaaccccaccacctcagtgacatctcagggcacccagactctggcccttcag
ctgcagaatgccgaaacacagacggaaagggagatacaggagccggggacagcagcttcg
ggtcctggtgaaggtgagggctccgagtacggtgcaggtggggaggacgccctcagcagg
atccagcggctgatggcagaagggggcatgacggctgtggtgcagcgggagcagagcacc
accatggcctccatgggcggcttcggcaacaacatcatcgtcagccaccgcattcaccgc
agctcccagacgggcacggagcccggcgccgcccgtgccacctcgccgcagccctccacc
tctcgggggctgctcccagaacctgggcaactggcagagcggggcctgagcccccggaca
gcttcctgggaccagcctggtacccctgggcgggagccctcgcagccaaccctgctctct
tcctcccctgtcccgccccctgtccccctccccagcactgagggaccaaccctgcactgc
gagctgaccagtacccgccaccttcctgacggtggtggcagcagcaggggggaggcggca
ggccccagtggggagccgcggaacaggtag

DBGET integrated database retrieval system