KEGG   Equus caballus (horse): 100050749
Entry
100050749         CDS       T01058                                 

Gene name
PRPF38A
Definition
(RefSeq) pre-mRNA-splicing factor 38A
  KO
K12849  pre-mRNA-splicing factor 38A
Organism
ecb  Equus caballus (horse)
Pathway
ecb03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    100050749 (PRPF38A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:ecb03041]
    100050749 (PRPF38A)
Spliceosome [BR:ecb03041]
 Complex B
  U4/U6.U5 tri-snRNP components
   U4/U6.U5 tri-snRNP related factors
    100050749 (PRPF38A)
 Complex C
   U4/U6.U5 tri-SnRNP related factors
    100050749 (PRPF38A)
SSDB
Motif
Pfam: PRP38 PRP38_assoc
Other DBs
NCBI-GeneID: 100050749
NCBI-ProteinID: XP_001490583
Ensembl: ENSECAG00000022628
VGNC: 21883
UniProt: F6UQW2
Position
2
AA seq 312 aa
MANRTVKDAHSIHGTNPQYLVEKIIRTRIYESKYWKEECFGLTAELVVDKAMELRFVGGV
YGGNIKPTPFLCLTLKMLQIQPEKDIIVEFIKNEDFKYVRMLGALYMRLTGTAIDCYKYL
EPLYNDYRKIKSQNRNGEFELMHVDEFIDELLHSERVCDIILPRLQKRYVLEEAEQLEPR
VSALEEDMDDVESSEEEEEEDEKLERVPSPDHRRRSYRDLDKPRRSPTLRYRRSRSRSPR
RRSRSPKRRSPSPRRERHRSKSPRRHRSRSRDRRHRSRSKSPGHHRSHRHRSHSKSPERS
KKSHKKSRRGNE
NT seq 939 nt   +upstreamnt  +downstreamnt
atggcgaaccggacggtgaaggatgcgcacagcatccacggcaccaaccctcagtatctg
gtggagaagatcattcggacgcgaatctatgagtccaagtactggaaagaggagtgcttt
ggacttacggctgaacttgtagtcgataaagccatggagttaaggtttgtgggtggagtc
tatggtggcaacataaagccaactccctttctgtgtttgaccttgaagatgcttcagatt
caacccgagaaggatatcattgtagagtttatcaaaaatgaagatttcaagtatgtccgc
atgttgggagcactttacatgaggctgacaggcactgcaattgattgctacaagtacttg
gagcctctgtacaacgactatcggaaaatcaagagccagaaccgaaatggagagtttgag
ctgatgcatgtcgacgagtttattgatgaactactgcacagtgagagagtctgtgacatc
attctgccccggctacagaaacgctatgtgctagaggaagctgagcagctggagcctcga
gttagcgctctagaagaggacatggatgacgtggagtccagtgaagaggaggaagaggag
gatgagaagttggagagagtgccatcacctgatcatcgccggagaagctaccgagacttg
gacaagccccgtcgctctcccacattacgctacaggaggagtaggagccggtctcccaga
agacggagtcggtctcccaagaggaggagcccctcccctcgccgagaaaggcatcggagc
aagagtccaagacgtcaccgcagcaggtcccgagatagacggcacagatctcgctccaag
tccccaggtcatcaccgtagtcacagacacaggagccactcaaagtctcctgaaagatct
aagaaaagccacaagaagagccggagaggaaatgagtaa

DBGET integrated database retrieval system