KEGG   Equus caballus (horse): 100050764Help
Entry
100050764         CDS       T01058                                 

Definition
(RefSeq) liver carboxylesterase-like isoform X2
  KO
K01044  carboxylesterase 1 [EC:3.1.1.1]
Organism
ecb  Equus caballus (horse)
Pathway
ecb00983  Drug metabolism - other enzymes
ecb01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ecb00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    100050764
Enzymes [BR:ecb01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     100050764
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: COesterase Abhydrolase_3 Peptidase_S9 Say1_Mug180 Esterase
Motif
Other DBs
NCBI-GeneID: 100050764
NCBI-ProteinID: XP_014593946
Ensembl: ENSECAG00000013389
Position
3
AA seq 552 aa AA seqDB search
MWLFALVLVSLATSTVWGHPSSPPVVDTAQGKVLGKHVSLEGFAQPVAVFLGVPFAKPPL
GSLRFAPPQPADPWPFVKNATSYPPMCSQDPVAGQIASDLFTIRKENIPVQFSEDCLYLN
IYTPADLTKKSRLPVMVWIHGGGLMVGGASTYDGLALSAHENVVVVTIQYRLGIWGFLST
GDEHSPGNWGHLDQVAALHWVQDNIANFGGDPGSVTIFGESAGGESVSVLVLSPLAKNLF
HRAISESGVAFTAGLVQKDSKAAAQQIAVFAGCKSTTSAVIVHCLRQKTDDELLELSLKM
SHPLLPTVVDGVLLPKMPEEILAEKTFNTVPYIVGINKQEFGWIIPTMMGYPLSEGKMDQ
RTATSLLQNSSTLLNIPEELTPVAIEKYLGGTDDPVKKKDLFLDLMGDVMFGVPSVTVAR
LHRDAGASTFMYEFQYRPSFSSAMRPKTVIGDHGDEIFSVFGAPFLKEGASEEEIKLSKM
VMKFWANFARTGSPNGEGLPHWPVYDQKEGYLQIGVTTQAAQKLKDKEVAFWTELLAKKA
AEKQQQTEHVEL
NT seq 1659 nt NT seq  +upstreamnt  +downstreamnt
atgtggctcttcgctctggtcctggtctccttggccacctccacagtttgggggcaccca
tcctcgccgcctgtggtggacaccgcgcagggcaaggtcctggggaagcatgtcagcctg
gaaggatttgcacagcccgtggccgttttcctgggggtcccttttgccaagccccccctg
ggatccctgaggtttgctccgccgcagcctgcagatccatggcccttcgtgaagaacgcc
acctcctaccctcccatgtgctcccaggacccagtggcagggcagatagcctcggacctc
tttaccataagaaaggagaacattcctgtccagttttctgaagactgtctttacctaaat
atttacactcccgctgacttgacaaaaaaaagcaggctgccggtgatggtgtggatccat
ggaggtggtctgatggtaggtggagcatcaacctatgatgggctggccctctctgcccat
gaaaacgtggtggtggtgaccattcagtaccgcctcggcatctggggattcctcagcaca
ggggacgagcacagccccggaaactggggtcacttggaccaggtggctgcattgcactgg
gtccaggataacatcgccaactttggaggggacccaggctccgtgacgatctttggagag
tcagcaggaggtgaaagtgtctctgttcttgtgttatctccactggccaagaacctcttc
caccgggccatctctgagagtggtgtggccttcactgctggcctggtccagaaggactcg
aaggccgcagctcagcaaattgctgtgtttgctgggtgcaaaagcacgacctcggctgtc
attgttcactgcctacgccagaagacagacgacgagctcttggagttgtcgctgaagatg
agccatcccttgctgcccactgtggttgatggagtgctgctgccaaagatgcctgaggag
attctggctgaaaagacgttcaacactgttccctacattgtcggaatcaacaagcaggag
tttggctggattattccaacgatgatgggctacccgctctctgaaggcaagatggaccag
aggacagccacgtcactcttgcagaactcctccaccctccttaacatccctgaggaactg
actccagtggccattgagaagtatttaggagggacagacgaccctgtcaaaaagaaagac
ctgttcctggacttgatgggggatgtgatgtttggtgtcccatctgtgactgtggcccgg
ctccacagagatgccggagcctccaccttcatgtatgagtttcagtaccgcccaagcttt
tcatcagccatgagacccaagacggtgataggggaccatggagatgagatcttctctgtc
ttcggggccccatttctaaaagagggtgcctcagaagaggagatcaaactcagcaagatg
gtgatgaaattctgggccaactttgctcggactgggagccccaatggtgaggggctgccc
cactggccagtgtacgaccagaaggaagggtacttgcagattggtgtcaccactcaggca
gcccagaagctgaaagataaggaagtggctttctggaccgagctcctggccaagaaggca
gcagagaagcaacaacagacagaacatgttgaactttga

DBGET integrated database retrieval system