KEGG   Equus caballus (horse): 100050866Help
Entry
100050866         CDS       T01058                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: chymase
  KO
K01329  chymase [EC:3.4.21.39]
Organism
ecb  Equus caballus (horse)
Pathway
ecb04614  Renin-angiotensin system
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09150 Organismal Systems
  09152 Endocrine system
   04614 Renin-angiotensin system
    100050866
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:ecb01002]
    100050866
Enzymes [BR:ecb01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.39  chymase
     100050866
Peptidases [BR:ecb01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   100050866
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin Trypsin_2 Peptidase_S29
Motif
Other DBs
NCBI-GeneID: 100050866
NCBI-ProteinID: XP_023478927
Position
1
AA seq 247 aa AA seqDB search
MHRLPLPLLFLLLCSRAEAGKIIGGTECKPHSRPYVAYLETVTSQHTLVTCGGFLIRQDF
VLTAAHCAGRSITVTLGAHNIKEKEDTWQKLEVAKQFPHPKYGDXNTHYDIMLLKLKKKV
NLTLAVGTLPLPPQFNFIPPGRMCLVAGWGMTEAEVLDSNTLQEVKLRLMDPQACRQFMT
FDHNLQLCVGNPRKXKSAFKGDSGGPLLCAGVAQGIVSYGRVDAKPPAVFTQISHYRPWI
NEVLKEN
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgcatcgtcttcctctccccctgctgttccttctcctgtgctccagagctgaagctggc
aagatcatcggaggcacagaatgcaagccacactcccgcccttacgtggcctacctggaa
actgtcacttcccagcataccctggtgacctgtggtggtttcctgataagacaggacttt
gtgctgacagctgctcactgtgcaggaaggtctataacagtcacccttggagcccataac
ataaaagagaaagaagacacatggcagaagcttgaggttgcaaaacaattccctcatcca
aaatatggcgactgaaatactcattatgacatcatgttactaaagttgaagaagaaagtc
aacctgaccctggctgtggggacactcccccttccaccccaattcaacttcatcccacct
gggaggatgtgcctggtggctggctggggaatgacagaagcagaggtattggactccaac
actctgcaagaggtgaagctgcgactcatggatccccaggcctgcagacagtttatgact
tttgaccacaatctccagctgtgtgttggcaatccaaggaagnacaaatctgcatttaag
ggagactcagggggtcctcttctatgtgctggggtggcccagggcattgtctcctatggc
cgggtggatgcaaagcctcctgctgtcttcacccagatctcccattaccggccctggatc
aatgaggtcctcaaggagaactaa

DBGET integrated database retrieval system