KEGG   Equus caballus (horse): 100050881
Entry
100050881         CDS       T01058                                 

Gene name
PSTPIP1
Definition
(RefSeq) proline-serine-threonine phosphatase-interacting protein 1 isoform X4
  KO
K12804  proline-serine-threonine phosphatase interacting protein 1
Organism
ecb  Equus caballus (horse)
Pathway
ecb04621  NOD-like receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    100050881 (PSTPIP1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ecb04131]
    100050881 (PSTPIP1)
Membrane trafficking [BR:ecb04131]
 Endocytosis
  Bin/Amphiphysin/Rvs (BAR) family proteins
   F-BAR proteins
    100050881 (PSTPIP1)
SSDB
Motif
Pfam: SH3_1 SH3_9 FCH SH3_2 SH3_3 DUF3347
Other DBs
NCBI-GeneID: 100050881
NCBI-ProteinID: XP_005602952
Ensembl: ENSECAG00000002988
VGNC: 21975
Position
1
AA seq 413 aa
MMPQLQFKDAFWCRDFTAHTGYEVLLQRLLDGRKMCKDVEELLRQRAQAEERYGKELVQI
ARKAGGQTEINSLRASFDSLKQQMENVGSSHIQLALALREELRSLEEFRERQKEQRKKYE
AVMDRVQKSKLSLYKKAMESKKTYEQKCRDADDAEQAFERISANGQQKQVEKSQNKAKQC
KDSATEAERVYRQSVEQLEKVRGEWEQEHRTTCEAFQLQEFDRLTILRNALWVHCNQLSM
QCVKDDELYEEVRVTLEGCSVDTDIDSFIQAKSTGTEPPAPVPYQNYYDREVAPASSSPG
VQPSCGMIKRFSGLLHGSPKTASVSASAETLTPTPNRNEGVYATIAVQEAPGPPTLPTQD
YRALYDYTAQNSDELDISAGDILEVILEGEDGWWTVERNGQRGFVPGSYLEKL
NT seq 1242 nt   +upstreamnt  +downstreamnt
atgatgccccagcttcagttcaaagatgccttttggtgcagggacttcacggcccacaca
ggctacgaggtgctgctgcagcggctgctggatggcaggaagatgtgcaaagacgtggag
gagctgctaaggcagagggcccaagcggaggagcggtacgggaaggagctggtacagatc
gcccggaaggctggcggccagacggagatcaactccctcagggcctcttttgactccctg
aagcaacaaatggagaacgtgggcagctcccatatccagctggccctggccctgcgagag
gagctgcggagcctcgaggagttccgtgagaggcagaaggagcagaggaagaagtacgag
gctgtcatggaccgtgtccagaagagcaagctgtcactctacaagaaggccatggaatcc
aagaagacatacgagcagaagtgccgggacgcggatgacgccgagcaggccttcgagcgc
attagtgccaatggccagcagaagcaggtggagaagagccagaacaaagccaagcagtgc
aaggactcagccacagaggcagaacgggtgtacaggcagagcgtcgagcagctggagaag
gtgcgaggcgagtgggagcaagagcaccggaccacctgcgaggccttccagctgcaggag
tttgaccggctgaccatcctccgcaacgccctgtgggtacactgcaaccagctctccatg
cagtgcgtcaaggatgacgagctctacgaggaggtgcgagtgacactggaaggctgcagt
gtggacaccgacattgacagcttcatccaggccaaaagcacgggcacggagcccccggct
ccggtgccctaccagaactactacgaccgggaggtggccccggcatccagcagccctggc
gtccagccatcttgcggtatgataaagaggttctccgggctgctgcatggaagtcccaag
actgcatcagtgtcagcgtctgcagagaccctgaccccgacccctaatcggaatgagggt
gtctatgccaccatcgcggtacaggaggcgccaggacctcctaccctgccaacccaagac
tacagggcactctatgactacacggcccagaattccgacgagctggacatctctgcaggg
gacatcctggaggtcatcctggaaggggaggatggctggtggacagtggaacggaatggg
cagcgtggctttgtccccggttcctacctggagaagctctga

DBGET integrated database retrieval system