KEGG   Equus caballus (horse): 100050936
Entry
100050936         CDS       T01058                                 

Gene name
FLOT1
Definition
(RefSeq) flotillin-1 isoform X1
  KO
K07192  flotillin
Organism
ecb  Equus caballus (horse)
Pathway
ecb04910  Insulin signaling pathway
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    100050936 (FLOT1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ecb04131]
    100050936 (FLOT1)
   03036 Chromosome and associated proteins [BR:ecb03036]
    100050936 (FLOT1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ecb04147]
    100050936 (FLOT1)
Membrane trafficking [BR:ecb04131]
 Endocytosis
  Lipid raft mediated endocytosis
   Flotillin-dependent endocytosis
    100050936 (FLOT1)
Chromosome and associated proteins [BR:ecb03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    100050936 (FLOT1)
Exosome [BR:ecb04147]
 Exosomal proteins
  Proteins found in most exosomes
   100050936 (FLOT1)
SSDB
Motif
Pfam: Band_7 Flot
Other DBs
NCBI-GeneID: 100050936
NCBI-ProteinID: XP_005614774
Ensembl: ENSECAG00000022083
VGNC: 18063
UniProt: F6Z0M9
Position
20
AA seq 427 aa
MFFTCGPNEAMVVSGFCRSPPVMVAGGRVFVLPCIQQIQRISLNTLTLNVKSEKVYTRHG
VPISVTGIAQVKIQGQNKEMLAAACQMFLGKTEAEIAQIALETLEGHQRAIMAHMTVEEI
YKDRQKFSEQVFKVASSDLVNMGISVVSYTLKDIHDDQDYLHSLGKARTAQVQKDARIGE
AEAKRDAGIREAKAKQEKVSAQYLSEIEMAKAQRDYELKKAAYDIEVNTRRAQADLAYQL
QVAKTKQQIEEQRVQVQVVERAQQVAVQEQEIARREKELEARVRKPAEAERYKLERLAEA
EKTQLIMQAEAEAESVRMRGEAEAFAIGARARADAEQMSKKAEAFQLYQEAAQLDMLLEK
LPQVAEEISGPLTSAKKITLVSSGSGTMGAAKVTGEVLDILSRLPECVERLTGVSISQVN
HKPLRTA
NT seq 1284 nt   +upstreamnt  +downstreamnt
atgtttttcacctgtggtccaaatgaggccatggtggtctccggtttctgccggagcccc
ccggtcatggtggctggaggacgtgtctttgtcctgccctgcatccagcaaatccagagg
atctctctcaacacactgaccctcaatgtcaagagtgaaaaggtttacactcgccatggg
gtccccatctcagtcactggcattgcccaggtgaaaatccaggggcagaacaaggagatg
ttggcagctgcctgccagatgttcctcgggaagactgaggctgagattgcccaaattgca
ctggagacgctggagggccaccagagggctatcatggcccacatgactgtagaggaaatc
tataaggacaggcagaaattctcagagcaagttttcaaagtggcctcctcagacctggtc
aacatgggcatcagtgtggttagctacaccctgaaggacattcatgatgaccaggactat
ttgcattccttggggaaggctcgaacagctcaagtccaaaaggatgctcggattggggag
gcggaagccaaaagagatgctgggatccgggaagccaaagccaagcaggaaaaggtgtct
gcccagtacctgagtgagatcgagatggccaaggcgcagagggactatgagctgaagaag
gccgcatatgacatcgaagtcaacacccgccgagcacaggctgacctggcctatcagctt
caggtggccaagactaagcaacagatcgaggagcagcgggtacaggtgcaggtggtggag
cgagcccagcaggtggcagtgcaggagcaggagattgcccgccgagagaaggagctggag
gcccgggtgcggaagccagcggaagctgagcgctacaagctggagcgcctagccgaggca
gagaagacccagctgattatgcaggcagaggcagaagctgaatctgtgcggatgcgtggg
gaggctgaggcctttgccataggggcccgagcccgggctgatgccgagcaaatgtccaag
aaggcagaagcattccagctgtaccaggaggctgctcagctggatatgctgctagagaag
ctgccccaggtggcagaggagatcagtggtcccttgacctcagccaagaagatcacactg
gtgtccagtggaagtggaaccatgggagcagccaaagtgactggggaagtcctggacatc
ctgagccgcctgccagagtgtgtggagagactcacaggcgtcagcatctcccaggtgaac
cacaagcctctgcgaacagcctga

DBGET integrated database retrieval system