KEGG   Equus caballus (horse): 100050973Help
Entry
100050973         CDS       T01058                                 

Gene name
TPP2
Definition
(RefSeq) tripeptidyl-peptidase 2 isoform X1
  KO
K01280  tripeptidyl-peptidase II [EC:3.4.14.10]
Organism
ecb  Equus caballus (horse)
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:ecb01002]
    100050973 (TPP2)
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:ecb03110]
    100050973 (TPP2)
Enzymes [BR:ecb01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.14  Dipeptidyl-peptidases and tripeptidyl-peptidases
    3.4.14.10  tripeptidyl-peptidase II
     100050973 (TPP2)
Peptidases and inhibitors [BR:ecb01002]
 Serine peptidases
  Family S8: subtilisin family
   100050973 (TPP2)
Chaperones and folding catalysts [BR:ecb03110]
 Intramolecular chaperones
  Subtilisin family
   100050973 (TPP2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_S8 TPPII TPPII_N
Motif
Other DBs
NCBI-GeneID: 100050973
NCBI-ProteinID: XP_023477569
Ensembl: ENSECAG00000000631
VGNC: 24439
Position
17
AA seq 1262 aa AA seqDB search
MATAATEEPFPFHGLLPKKETGAASFLCRYPEYDGRGVLIAVLDTGVDPGAPGMQVTTDG
KPKIIDIIDTTGSGDVNTATVVEPKDGEIIGLSGRVLKIPASWINPSGRYHIGIKNGYDF
YPKALKERLQKERKEKIWDPVHRVALAEACRKQEEFDVANNCPSQANKLIKEELQSQVEL
LNSFEKKYSDPGPVYDCLVWHDGEAWRACIDSNEDGDLSKSTVLRNYKEAQEYGSFGTAE
MLNYSVNIYDDGNLLSIVTSGGAHGTHVASIAAGHFPEEPERNGVAPGAQILSVKIGDTR
LSTMETGTGLIRAMIEVINHKCDLVNYSYGEATHWPNSGRICEVISEAVWKHNIIYVSSA
GNNGPCLSTVGCPGGTTSSVIGVGAYVSPDMMVAEYSLREKLPANQYTWSSRGPSADGAL
GVSISAPGGAIASVPNWTLRGTQLMNGTSMSSPNACGGIALILSGLKTNDVNYTVHSVRR
ALENTAVKADNIEVFAQGHGIIQVDKAYDYLVQNTSFANKLGFTVTVGNNRGIYLRDPVQ
VAAPSDHGVGIEPVFPENTENSEKISLQLHLALTSNSSWVQCPSHLELMNQCRHINIRVD
PRGLREGLHYTEVCGYDIASPNAGPLFRVPITAVIAAKVSESSHYDLAFTDVHFKPGQIR
RHFIEVPEGATWAEVTVCSCSSEVSAKFVLHAVQLVKQRAYRSHEFYKFCSLPEKGTLTE
AFPVLGGKAIEFCIARWWASLSDVNIDYTISFHGIVCTAPQLNIHASEGINRFDVQSSLK
YEDLAPCITLKSWVQTLRPLSAKTKPLGSRDVLPNNRQLYEMILTYNFHQPKSGEVTPSC
PLLCELLYESEFDSQLWIIFDQNKRQMGSGDAYPHQYSLKLEKGDYTIRLQIRHEQISDL
ERLKDLPFIVSHRLSNTLSLDIHENHSLALLGKKKSSNLTLPPKYNQPFFVTSLPDDKIP
KGAGPGCYLAGSLTLSKTELGKKAGQSAAKRQGKFKKDVIPVHYYLISPPTKSKNGSKDK
EKDSEKDKDLKEEFTEALRDLKIQWMTKLDSSDIYNELKETYPNYLPLYVARLHQLDAEK
ERMKRLNEIVEAANAVISHIDQTALAIYIAMKTDPRPDAATIKNDMDKQKSTLVDALCRK
GCALADHLLHAQDQDGAVSSDAEGREEEGESTLDSLAETFWETTKWTDLFDNKVLTFAYK
HALVNKMYGRGLKFATKLVEEKPTKENWKNCIQLMKLLGWTHCASFTENWLPIMYPPDYC
VF
NT seq 3789 nt NT seq  +upstreamnt  +downstreamnt
atggccaccgccgcgactgaggagcccttccccttccacggcctgctcccgaagaaagag
accggggccgcctccttcctctgtcgctacccggaatatgacgggcgaggggtgctcatc
gccgtcctggacacgggggtcgaccccggggctccgggcatgcaggttacaactgatgga
aaaccaaaaatcattgatatcattgacacaacaggaagtggtgatgtgaatactgccaca
gtagtagagccaaaagacggggaaattattggtctctcaggaagagtgcttaagattcct
gcgagttggataaatccctcaggcaggtatcacattggcataaaaaatggctatgacttc
tatccaaaggctctcaaggaaaggttacagaaagaacggaaggaaaaaatctgggaccct
gttcacagagtggcccttgcagaagcctgtagaaaacaggaagaatttgatgttgccaac
aattgcccttctcaagcaaataaactaatcaaagaggagcttcaaagtcaagtggaattg
ctaaattcttttgagaaaaaatacagtgatcctggccctgtgtatgactgcttggtatgg
catgatggtgaagcctggagagcctgcattgattcgaatgaagacggggacttgagtaaa
tctactgttttgagaaactacaaagaggcccaggaatatggctcttttggcacagctgag
atgttgaattactctgttaatatatatgatgatggaaacctgctctccattgtgaccagc
ggaggggctcatggaacacatgtagctagtatagctgctggacattttccagaagaacct
gaacggaatggtgtagctcctggtgcccaaattctttcagtcaagattggtgatacgaga
ctaagcacaatggagacaggcaccggccttatacgagctatgatagaagttataaatcat
aagtgtgatcttgtcaactatagctatggagaagcaactcactggccaaattcagggaga
atttgtgaagtaattagtgaagcagtgtggaagcacaatataatttatgtttcaagtgcc
ggaaataacggtccatgcctgtctacagtcggttgtccaggtggaactacgtcaagtgta
ataggtgttggtgcctatgtttctcctgatatgatggttgctgagtattctctgagagag
aaattacctgcaaatcaatacacgtggtcttctagaggccccagtgctgatggagccctt
ggagtgagtatcagtgcaccaggaggagccattgcttctgttcctaactggacattgaga
ggaactcagctaatgaacgggacgtctatgtcttctcccaatgcgtgtgggggcatcgcc
ctgatactttcaggtctgaaaactaatgatgttaactacacagttcattcagtcagaaga
gctctagaaaacaccgcggtgaaggctgataatatagaagtatttgcccaaggacatggt
attattcaggttgataaagcctatgactacctcgttcagaatacatcatttgctaataag
ttaggtttcactgttactgttggaaataaccgtggcatctacctccgagatcctgttcag
gtggctgcaccttcagatcatggtgttggcattgaacctgtatttccagaaaatacggaa
aactctgaaaaaatatcccttcagcttcatttagctttaacttcaaattcgtcttgggtt
cagtgtcccagccatttggagctcatgaatcagtgtagacacataaacatacgtgtggat
cccaggggcttaagagaaggcttgcattacacagaggtctgtggctatgatatagcatca
cctaatgcaggtcctctgttcagagttccaattactgcagtgatagcagcaaaagtaagt
gaatcatcacactatgatctagcctttacagatgtacattttaaacctggtcagattcga
aggcattttattgaggttcctgagggtgcaacgtgggctgaagttacagtgtgctcatgt
tcttctgaggtgtccgccaaatttgttcttcacgcagtacagcttgtgaagcaaagagca
tatcgaagtcatgaattctataagttttgttcccttccagaaaaaggaacactgaccgag
gcttttcctgtcttgggtgggaaagcaattgaattttgcattgctcgttggtgggcaagt
cttagtgatgtcaatattgattataccatttctttccatgggatagtgtgcactgctcct
cagttaaacattcatgcatcggaaggaatcaaccgatttgatgttcagtcctccttgaaa
tatgaagatctggctccgtgcataactttgaagagctgggttcaaacactacgcccactg
agtgcaaaaacaaaacctttaggatcaagagatgttttgccaaataatcgtcaactttat
gagatgatcctgacatataactttcatcaacccaagagtggggaagtaactccaagctgc
ccgctactttgtgaattattatatgaatcagaatttgacagccaactgtggatcatattt
gaccagaataaaagacagatgggttcaggtgatgcctatccacatcagtattctctgaag
ctggagaaaggagattatacaattcgactacagattcgtcatgagcaaatcagtgatttg
gaacgtctcaaagatcttccatttattgtgtctcataggttgtctaataccttgagctta
gatattcatgaaaatcatagccttgcacttctaggaaagaagaaatcaagtaatttgaca
ttaccacccaagtataatcagccattctttgttacttccttacctgatgataaaataccc
aaaggagcagggccaggatgctaccttgcaggatccttaacgttgtcaaagactgaactt
ggaaagaaagctgggcagtctgcagcaaaacgacaaggaaagtttaaaaaggatgtaatc
cctgttcattactacctaatatctccaccaacaaagagtaagaatggcagtaaagataaa
gaaaaagattcagaaaaagataaagatttaaaagaagagtttactgaagcattacgagat
cttaaaattcaatggatgacaaagctggattctagtgacatttataatgaattgaaagaa
acgtatcctaattatcttcctctatatgttgctcgacttcatcagttggatgctgaaaag
gaacgaatgaaaagacttaatgaaattgttgaagccgcaaatgctgttatttctcatata
gatcagacggccctagccatttatattgcaatgaagactgaccctaggcccgatgcagct
actataaaaaatgacatggacaaacaaaaatccaccctagtagatgccctttgtagaaaa
ggctgtgccctggccgaccatcttcttcacgcgcaggatcaggacggggccgtgtcaagt
gatgcagagggaagggaggaagaaggagaaagtactctggattctctggcggaaactttt
tgggaaactacaaaatggactgatctttttgacaataaggttttgacatttgcatacaaa
catgcattagtaaataaaatgtatgggagaggccttaaatttgcaactaaacttgtggaa
gaaaagccaacaaaagaaaactggaaaaattgtattcaactgatgaagctgcttggatgg
acccattgtgcgtcttttactgaaaactggctccccatcatgtatcctcctgattattgt
gtattctaa

DBGET integrated database retrieval system