KEGG   Equus caballus (horse): 100050992Help
Entry
100050992         CDS       T01058                                 

Definition
(RefSeq) liver carboxylesterase isoform X3
  KO
K01044  carboxylesterase 1 [EC:3.1.1.1]
Organism
ecb  Equus caballus (horse)
Pathway
ecb00983  Drug metabolism - other enzymes
ecb01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ecb00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    100050992
Enzymes [BR:ecb01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     100050992
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: COesterase Abhydrolase_3 Say1_Mug180 Peptidase_S9 Esterase
Motif
Other DBs
NCBI-GeneID: 100050992
NCBI-ProteinID: XP_001491752
Ensembl: ENSECAG00000019927
UniProt: F6UN85
Position
3
AA seq 565 aa AA seqDB search
MWLFALVLVSLATSTVWGHPSSPPVVDTAQGKVLGKHVSLEGFAQPMAVFLGVPFAKPPL
GSLRFAPPQPADPWPFVKNTTSYPPMCSQDTVAGQMLSDLFTNRKENISVQISEDCLYLN
IYTPADLTKKSRLPVMVWIHGGGLMIGGASTYDGLALSAHENVVVVTIQYRLGIWGFFST
GDEHSPGNWGHLDQVAALRWVQENIANFGGDPGSVTIFGESAGGESVSVLVLSPLAKNLF
HRAISESGVAFTAGLVQKDSKAAAQQIAVFAGCKTATSAVIVHCLRQKTEDELLETSVKM
KFLSLDFRGDSRESHPFLPAVVDGVLLPKMPEEILAEKTFNTVPYIIGINKQEFGWVIPM
MMGYPLSEGKLDQKTATSLLQKSCPILNIPEEVTPVATEKYLGGTEDPVKKKDLFLDLIG
DVMFGVPSVTVARLHRDAGASTFMYEFQYRPSFSSVMKPKTVIGDHGDEIFSVFGAPFLK
EGASEEEIKLSKMVMKFWANFARNGNPNGEGLPHWPAYDQKEGYLQIGVTTQAAQKLKDK
EVAFWTELLAKEAAEKQQQTEHVEL
NT seq 1698 nt NT seq  +upstreamnt  +downstreamnt
atgtggctcttcgctctggtcctggtctccttggccacttctacagtctgggggcaccca
tcctcgccgcctgtggtggacaccgcgcagggcaaggtcctggggaagcacgtcagcctg
gaaggatttgcacagcccatggccgttttcctgggggtcccttttgccaagccccccctg
ggatccctgaggtttgctccgccgcagcctgcagacccatggcccttcgtgaagaacacc
acctcctaccctcccatgtgctcccaggacacagtggcagggcagatgctctcagacctc
tttaccaacagaaaggagaacatttctgtccagatttctgaagactgtctttacctaaat
atttatactcctgctgacttgacaaagaaaagcaggctgccggtgatggtgtggatccac
ggaggtggtctgatgataggtggagcatcaacctatgatgggctggccctctctgcccat
gaaaacgtggtggtggtgaccattcagtaccgcctgggcatctggggattcttcagcaca
ggggacgaacacagcccaggaaactggggtcacttggaccaggtggccgcactgcgctgg
gttcaggagaacatcgccaactttggaggggacccaggctccgtgaccatctttggagag
tcagctggaggtgaaagtgtctctgttcttgtgttatctccactggccaagaacctcttc
caccgggccatctctgagagtggggtggccttcactgctggcctggtccagaaggactcg
aaggccgcggctcagcaaattgctgtgtttgctgggtgtaaaaccgcgacctcggctgtc
attgttcactgcctgcgccagaagacagaggacgagctcctggagacgtcagtgaagatg
aaatttctcagtcttgatttccgtggagactccagagagagccatcccttcctgcccgct
gtggttgatggagtgctgctgccaaagatgcctgaggagattctggctgaaaagacgttc
aacactgttccctacatcatcggaatcaataagcaagagttcggctgggttattccaatg
atgatgggctacccgctctctgaaggcaagctggaccagaagacggccacgtcactcttg
cagaagtcctgccccatccttaacatccctgaggaagtgactccagtggccactgagaag
tatttaggagggactgaagatcctgtcaaaaagaaagacctgttcctggacttgataggc
gatgtgatgtttggtgtcccatctgtgactgtggcccgtctccacagagatgccggagcc
tccaccttcatgtatgagtttcagtaccgcccaagcttctcatcagtcatgaaacccaag
acggtgataggggaccatggagatgagatcttctctgtcttcggggccccatttctaaaa
gagggtgcctcagaagaggagatcaaactcagcaagatggtgatgaaattctgggccaac
tttgctcggaatgggaaccccaatggtgaggggctgccccactggccagcatatgaccag
aaggaaggctacctgcagattggtgtcaccacccaggcagcccagaagctgaaagacaag
gaagtggctttctggaccgagctcctggccaaggaggcagcagagaagcaacaacagaca
gaacacgttgaactttga

DBGET integrated database retrieval system