KEGG   Equus caballus (horse): 100051106Help
Entry
100051106         CDS       T01058                                 

Gene name
CAPN1
Definition
(RefSeq) calpain-1 catalytic subunit
  KO
K01367  calpain-1 [EC:3.4.22.52]
Organism
ecb  Equus caballus (horse)
Pathway
ecb04141  Protein processing in endoplasmic reticulum
ecb04210  Apoptosis
ecb04217  Necroptosis
ecb04218  Cellular senescence
ecb05010  Alzheimer's disease
Brite
KEGG Orthology (KO) [BR:ecb00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100051106 (CAPN1)
 Cellular Processes
  Cell growth and death
   04210 Apoptosis
    100051106 (CAPN1)
   04217 Necroptosis
    100051106 (CAPN1)
   04218 Cellular senescence
    100051106 (CAPN1)
 Human Diseases
  Neurodegenerative diseases
   05010 Alzheimer's disease
    100051106 (CAPN1)
Enzymes [BR:ecb01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.52  calpain-1
     100051106 (CAPN1)
Peptidases [BR:ecb01002]
 Cysteine Peptidases
  Family C2: calpain family
   100051106 (CAPN1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_C2 Calpain_III EF-hand_8 EF-hand_1 EF-hand_6 EF-hand_7
Motif
Other DBs
NCBI-GeneID: 100051106
NCBI-ProteinID: XP_014585175
Ensembl: ENSECAG00000022942
VGNC: 16037
Position
12
AA seq 715 aa AA seqDB search
MAEEIITPIYCTGVSAQVQKHRAKELGLGRHENAIKYLGQNYDQLQAQCLQSGVLFRDEA
FPPVPQSLGFKELGPNSSKTYGIKWKRPTELFSNPQFIVDGATRTDICQGALGDCWLLAA
IACLTLNDTLLHRVVPHGQSFQNGYAGIFHFQLWQFGEWVDVVVDDLLPTKDGKLVFVHS
AQGNEFWSALLEKAYAKVNGSYEALSGGSTSEGFEDFTGGVTEWYELRKAPSDLYHIILK
ALERGSLLGCSIDISSVLDMEAVTFKKLVKGHAYSVTGAKQVNYQGQMVSLIRMRNPWGE
VEWTGAWSDGSSEWNNVDPYEREQLRVKMEDGEFWMSFRDFMREFTRLEICNLTPDALQS
RKFRKWNTTLYEGTWRRGSTAGGCRNYPATFWVNPQFKIQLEEPDDPDDDYGGRESGCSF
VLALMQKNRRRERRFGRDMETIGFAVYEVPRELVGQPAVHLKRDFFLANSSRARSEQFIN
LREVSTRFRLPPGEYVVVPSTFEPNKEGDFVLRFFSEKKAGTQELDDQIQANLPDEQVLS
EQEIDETFKNLFRQLAGTDMEISVRELQTILNRIISKHKDLRTKGFSLESCRSMVNLMDR
DGNGKLGLVEFNILWNRIRNYLSIFRKFDLDKSGSMSAYEMRMAIESAGFKLNKKLYELI
ITRYSEPDLAVDFDNFVCCLVRLETMFRFFKTLDTDLDGVVTFDLFKWLQLTMFA
NT seq 2148 nt NT seq  +upstreamnt  +downstreamnt
atggctgaggagatcatcaccccaatatactgcaccggggtgtctgcacaagtgcagaag
caccgggccaaggagctgggcctgggccgccatgaaaacgccatcaagtacttgggccag
aattatgaccagctgcaggctcagtgcctgcagagtggggtcctctttcgtgatgaggcc
ttccccccagtgccccaaagcttgggctttaaggaactgggccccaactcctccaaaacc
tatggcatcaagtggaagcgtcccacggagctgttctcaaacccccagttcatcgtggat
ggagctacccgcacagacatctgccagggagccctgggggactgttggctgctggctgcc
atcgcctgcctcaccctcaacgacaccctcctgcaccgagtggttcctcatggccaaagc
ttccagaatggctatgctggcatcttccatttccagctgtggcagtttggggagtgggtg
gacgtggtcgtggatgacctgctgcccaccaaggacgggaagctggtgttcgtgcactct
gcccaaggcaacgagttctggagcgccctgctcgagaaggcctatgccaaggtgaacggc
agctatgaggccctctcggggggcagcacctcagagggctttgaggactttacaggcggg
gtcaccgagtggtacgagctgcgcaaggcgcccagcgacctctaccacatcatcctcaag
gcgctggaacgaggctccctgctgggctgctccattgacatctccagtgttctggacatg
gaggccgtcaccttcaagaagctggtgaagggccatgcctactctgtgactggggccaag
caggttaactaccagggccagatggtgagcctgatccggatgcggaacccctggggcgag
gtggagtggacaggagcctggagtgatggctcctcggagtggaacaacgtggacccttac
gaacgggagcagctccgggtcaagatggaggacggagagttctggatgtcattccgagac
ttcatgcgtgagttcacccgcctggagatctgcaacctgacgcctgacgcgctccagagc
cggaagttccgcaaatggaacaccacgctctacgagggcacctggcggcgggggagcacg
gcggggggctgccggaactacccagccaccttctgggtgaaccctcagttcaagatccag
ctggaggagccagatgacccggatgacgactacgggggccgcgagtcaggctgcagcttc
gtgctcgccctcatgcagaagaaccgccgccgcgagcgccgcttcggccgcgatatggag
accattggcttcgcggtctacgaggtccctcgggagctggtgggccagccggccgtgcac
ctgaagcgggacttcttcctggccaactcgtcgcgggcccgatcggagcagtttatcaac
ctgcgcgaggtcagcacccgcttccgcctgccgcccggggagtacgtggtggtgccgtcc
accttcgagcccaacaaggagggcgacttcgtgctacgcttcttctcggagaagaaagcc
gggacccaggagctggacgaccagatccaggccaatctccctgatgagcaagtgctgtca
gaacaggagattgacgagaccttcaagaacctcttcagacaactggcagggacggacatg
gagatcagcgtcagggagctgcagaccattctcaacaggatcatcagcaaacacaaagac
ctgcggaccaagggcttcagcctggagtcgtgccgcagcatggtgaacctcatggatcgg
gacggcaacgggaagctgggcctggtggagttcaacatcctgtggaaccgcatccggaat
tacctgtccatcttccggaagtttgacttggacaagtcgggcagcatgagcgcctacgag
atgcggatggccatcgagtctgcaggcttcaagctcaacaagaagctgtatgagctcatt
atcacccgctactcggagcccgacctggccgtggactttgacaacttcgtgtgctgcctg
gtgcggctggagaccatgttccggtttttcaaaactctggacacagatctggatggagtc
gtgacctttgacttgtttaagtggttacagctgaccatgtttgcctga

DBGET integrated database retrieval system