KEGG   Equus caballus (horse): 100051272
Entry
100051272         CDS       T01058                                 

Gene name
ELOVL7
Definition
(RefSeq) elongation of very long chain fatty acids protein 7 isoform X1
  KO
K10250  elongation of very long chain fatty acids protein 7 [EC:2.3.1.199]
Organism
ecb  Equus caballus (horse)
Pathway
ecb00062  Fatty acid elongation
ecb01040  Biosynthesis of unsaturated fatty acids
ecb01100  Metabolic pathways
ecb01212  Fatty acid metabolism
Module
ecb_M00415  Fatty acid elongation in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09100 Metabolism
  09103 Lipid metabolism
   00062 Fatty acid elongation
    100051272 (ELOVL7)
   01040 Biosynthesis of unsaturated fatty acids
    100051272 (ELOVL7)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:ecb01004]
    100051272 (ELOVL7)
Enzymes [BR:ecb01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.199  very-long-chain 3-oxoacyl-CoA synthase
     100051272 (ELOVL7)
Lipid biosynthesis proteins [BR:ecb01004]
 Elongase
  PUFA
   100051272 (ELOVL7)
SSDB
Motif
Pfam: ELO
Other DBs
NCBI-GeneID: 100051272
NCBI-ProteinID: XP_023481409
Ensembl: ENSECAG00000007176
VGNC: 17543
Position
21
AA seq 281 aa
MAFSDLTSRTMRLYDNWIKHADPRVEDWLLMSSPLPQTIILVLYVYFVTSLGPKLMENRK
PFDLKKVMITYNFFIVLFSVYLCYEFVMSGWGTGYSLRCEIVDYSWSPTALRMARTCWLY
YFSKFIELLDTIFFVLRKKNSQVTFLHVFHHTIMPWTWWFGVKFAAGGLGTFHAFLNTAV
HVVMYSYYGLCALGPAYQQYLWWKKYLTSLQLVQFLIVTIHVSQFFFMEDCKYQFPVFLY
IIMSYGCIFLLLFLHFWYRAYTKGQRLPKTMKNGICKNKDH
NT seq 846 nt   +upstreamnt  +downstreamnt
atggccttcagtgatcttacgtcgaggaccatgcgtctttatgataattggatcaaacat
gctgatccaagagttgaagactggctcctcatgtcctcgcctctgccacaaaccatcatc
ctggtactctatgtctattttgtcacttctctgggaccaaagctcatggagaatcgaaag
ccctttgacctcaagaaagtgatgataacgtacaattttttcatagtactcttttctgtg
tatctgtgttatgagtttgtgatgtctggctggggtacaggttattcattacgatgtgaa
attgttgactattcatggtcacccacagctttgaggatggcacgcacctgctggctttat
tacttctccaaatttatcgagctgttagatactatcttttttgttctgcgtaagaaaaat
agccaagtgactttcctgcacgtcttccatcataccatcatgccatggacctggtggttt
ggagtcaaatttgctgcaggtggtttgggaacattccatgcctttctaaatacagctgta
catgtagtcatgtattcttactatggactgtgtgcattgggaccagcttaccagcagtat
ttgtggtggaaaaaatatttgacatcattacagcttgtccagttccttattgtcaccatc
cacgtaagccagttctttttcatggaggattgcaagtaccagtttccggtctttctgtac
atcattatgagttatggatgcatctttctgctgctctttctccatttttggtaccgtgct
tacaccaaaggtcagaggctgcccaaaactatgaaaaatggaatctgcaaaaacaaagat
cattga

DBGET integrated database retrieval system