KEGG   Equus caballus (horse): 100051282Help
Entry
100051282         CDS       T01058                                 

Gene name
GNAO1
Definition
(RefSeq) guanine nucleotide-binding protein G(o) subunit alpha isoform X1
  KO
K04534  guanine nucleotide-binding protein G(o) subunit alpha
Organism
ecb  Equus caballus (horse)
Pathway
ecb04015  Rap1 signaling pathway
ecb04713  Circadian entrainment
ecb04723  Retrograde endocannabinoid signaling
ecb04724  Glutamatergic synapse
ecb04725  Cholinergic synapse
ecb04726  Serotonergic synapse
ecb04727  GABAergic synapse
ecb04728  Dopaminergic synapse
ecb04730  Long-term depression
ecb04915  Estrogen signaling pathway
ecb04916  Melanogenesis
ecb04921  Oxytocin signaling pathway
ecb04926  Relaxin signaling pathway
ecb05032  Morphine addiction
ecb05034  Alcoholism
ecb05142  Chagas disease (American trypanosomiasis)
ecb05145  Toxoplasmosis
ecb05163  Human cytomegalovirus infection
ecb05170  Human immunodeficiency virus 1 infection
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    100051282 (GNAO1)
 09150 Organismal Systems
  09152 Endocrine system
   04915 Estrogen signaling pathway
    100051282 (GNAO1)
   04921 Oxytocin signaling pathway
    100051282 (GNAO1)
   04926 Relaxin signaling pathway
    100051282 (GNAO1)
   04916 Melanogenesis
    100051282 (GNAO1)
  09156 Nervous system
   04724 Glutamatergic synapse
    100051282 (GNAO1)
   04727 GABAergic synapse
    100051282 (GNAO1)
   04725 Cholinergic synapse
    100051282 (GNAO1)
   04728 Dopaminergic synapse
    100051282 (GNAO1)
   04726 Serotonergic synapse
    100051282 (GNAO1)
   04730 Long-term depression
    100051282 (GNAO1)
   04723 Retrograde endocannabinoid signaling
    100051282 (GNAO1)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100051282 (GNAO1)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    100051282 (GNAO1)
   05034 Alcoholism
    100051282 (GNAO1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100051282 (GNAO1)
   05163 Human cytomegalovirus infection
    100051282 (GNAO1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100051282 (GNAO1)
   05142 Chagas disease (American trypanosomiasis)
    100051282 (GNAO1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ecb04147]
    100051282 (GNAO1)
   04031 GTP-binding proteins [BR:ecb04031]
    100051282 (GNAO1)
Exosome [BR:ecb04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100051282 (GNAO1)
GTP-binding proteins [BR:ecb04031]
 Heterotrimeric G-proteins
  Alpha Subunits
   Alpha type 1 (Gi/o) [OT]
    100051282 (GNAO1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: G-alpha Arf Gtr1_RagA Roc TniB AAA_29 DUF685
Motif
Other DBs
NCBI-GeneID: 100051282
NCBI-ProteinID: XP_001492446
Ensembl: ENSECAG00000013133
VGNC: 18418
UniProt: A0A3Q2LGA4
Position
3
AA seq 354 aa AA seqDB search
MGCTLSAEERAALERSKAIEKNLKEDGISAAKDVKLLLLGAGESGKSTIVKQMKIIHEDG
FSGEDVKQYKPVVYSNTIQSLAAIVRAMDTLGIEYGDKERKADAKMVCDVVSRMEDTEPF
SAELLSAMMRLWGDSGIQECFNRSREYQLNDSAKYYLDSLDRIGAADYQPTEQDILRTRV
KTTGIVETHFTFKNLHFRLFDVGGQRSERKKWIHCFEDVTAIIFCVALSGYDQVLHEDET
TNRMHESLKLFDSICNNKWFTDTSIILFLNKKDIFEEKIKKSPLTICFPEYTGPSAFTEA
VAYIQAQYESKNKSTHKEIYTHVTCATDTNNIQFVFDAVTDVIIAKNLRGCGLY
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgggatgtactctgagcgcagaggagagagccgccctcgagcggagcaaggcgattgag
aaaaacctcaaagaggatggcatcagcgccgccaaagacgtgaaattactcctgctgggg
gctggagaatcaggaaaaagcaccattgtgaagcagatgaagatcatccacgaagatggc
ttctctggagaagacgtgaaacagtacaagcctgttgtctacagcaacaccatccaatcc
ctggcagccatcgtccgagccatggacactttgggcatcgaatatggtgacaaggagaga
aaggccgacgccaagatggtgtgtgacgtggtgagtcggatggaagacaccgagcccttc
tctgcagagctgctttccgccatgatgcgactctggggcgactcaggaatccaggagtgc
ttcaacaggtctcgggagtatcagctcaacgactccgccaaatactacctggacagcctg
gatcggatcggggccgctgactaccagcccaccgagcaggacatcctccgaaccagggtc
aaaaccaccggcatcgtagaaacccacttcaccttcaagaaccttcacttcaggctgttc
gacgtcgggggccaacgatctgaacgcaagaagtggatccactgcttcgaggacgtcacg
gccatcatcttctgcgtcgcactcagcggctatgaccaggtgctccacgaagacgagacc
acgaaccgcatgcacgaatccctgaagcttttcgacagcatctgcaacaacaaatggttc
acagacacgtccatcatcctgtttcttaacaagaaggacatatttgaagagaagatcaag
aagtccccgctaaccatctgctttcctgagtacacaggccccagcgccttcacagaagcc
gtggcttacatccaggcccagtacgagagcaagaacaagtcgacccacaaggagatctat
acccacgtcacctgtgccactgacaccaacaacatccagtttgtctttgatgctgtgaca
gatgtcatcatcgccaaaaacctgcggggctgtggcctctactga

KEGG   Equus caballus (horse): 100051430Help
Entry
100051430         CDS       T01058                                 

Gene name
GNGT1
Definition
(RefSeq) guanine nucleotide-binding protein G(T) subunit gamma-T1
  KO
K04548  guanine nucleotide-binding protein G(T) subunit gamma-T1
Organism
ecb  Equus caballus (horse)
Pathway
ecb04014  Ras signaling pathway
ecb04062  Chemokine signaling pathway
ecb04151  PI3K-Akt signaling pathway
ecb04371  Apelin signaling pathway
ecb04713  Circadian entrainment
ecb04723  Retrograde endocannabinoid signaling
ecb04724  Glutamatergic synapse
ecb04725  Cholinergic synapse
ecb04726  Serotonergic synapse
ecb04727  GABAergic synapse
ecb04728  Dopaminergic synapse
ecb04744  Phototransduction
ecb04926  Relaxin signaling pathway
ecb05032  Morphine addiction
ecb05034  Alcoholism
ecb05163  Human cytomegalovirus infection
ecb05167  Kaposi sarcoma-associated herpesvirus infection
ecb05170  Human immunodeficiency virus 1 infection
ecb05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    100051430 (GNGT1)
   04371 Apelin signaling pathway
    100051430 (GNGT1)
   04151 PI3K-Akt signaling pathway
    100051430 (GNGT1)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    100051430 (GNGT1)
  09152 Endocrine system
   04926 Relaxin signaling pathway
    100051430 (GNGT1)
  09156 Nervous system
   04724 Glutamatergic synapse
    100051430 (GNGT1)
   04727 GABAergic synapse
    100051430 (GNGT1)
   04725 Cholinergic synapse
    100051430 (GNGT1)
   04728 Dopaminergic synapse
    100051430 (GNGT1)
   04726 Serotonergic synapse
    100051430 (GNGT1)
   04723 Retrograde endocannabinoid signaling
    100051430 (GNGT1)
  09157 Sensory system
   04744 Phototransduction
    100051430 (GNGT1)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100051430 (GNGT1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100051430 (GNGT1)
  09165 Substance dependence
   05032 Morphine addiction
    100051430 (GNGT1)
   05034 Alcoholism
    100051430 (GNGT1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100051430 (GNGT1)
   05163 Human cytomegalovirus infection
    100051430 (GNGT1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100051430 (GNGT1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:ecb04031]
    100051430 (GNGT1)
GTP-binding proteins [BR:ecb04031]
 Heterotrimeric G-proteins
  Gamma Subunits
   Gamma [OT]
    100051430 (GNGT1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: G-gamma DUF2508
Motif
Other DBs
NCBI-GeneID: 100051430
NCBI-ProteinID: XP_001492841
Ensembl: ENSECAG00000018842
VGNC: 18437
UniProt: F7B1I8
Position
4
AA seq 74 aa AA seqDB search
MPVINIEDLTEKDKLKMEVDQLKKEVTLERMLVSKCCEEVRDYVEERSGEDPLVKGIPED
KNPFKELKGGCVIS
NT seq 225 nt NT seq  +upstreamnt  +downstreamnt
atgccagtgatcaatattgaggacctgacagaaaaggacaagttgaagatggaagttgat
cagctcaagaaagaagtaacgctggaaagaatgctggtatccaaatgttgtgaagaagtg
agggattatgttgaagaaagatctggggaggacccactagtaaagggcatcccagaggac
aaaaaccccttcaaggagctcaaaggaggttgtgtgatttcataa

KEGG   Equus caballus (horse): 100051499Help
Entry
100051499         CDS       T01058                                 

Gene name
GNG11
Definition
(RefSeq) guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-11
  KO
K04546  guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-11
Organism
ecb  Equus caballus (horse)
Pathway
ecb04014  Ras signaling pathway
ecb04062  Chemokine signaling pathway
ecb04151  PI3K-Akt signaling pathway
ecb04371  Apelin signaling pathway
ecb04713  Circadian entrainment
ecb04723  Retrograde endocannabinoid signaling
ecb04724  Glutamatergic synapse
ecb04725  Cholinergic synapse
ecb04726  Serotonergic synapse
ecb04727  GABAergic synapse
ecb04728  Dopaminergic synapse
ecb04926  Relaxin signaling pathway
ecb05032  Morphine addiction
ecb05034  Alcoholism
ecb05163  Human cytomegalovirus infection
ecb05167  Kaposi sarcoma-associated herpesvirus infection
ecb05170  Human immunodeficiency virus 1 infection
ecb05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    100051499 (GNG11)
   04371 Apelin signaling pathway
    100051499 (GNG11)
   04151 PI3K-Akt signaling pathway
    100051499 (GNG11)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    100051499 (GNG11)
  09152 Endocrine system
   04926 Relaxin signaling pathway
    100051499 (GNG11)
  09156 Nervous system
   04724 Glutamatergic synapse
    100051499 (GNG11)
   04727 GABAergic synapse
    100051499 (GNG11)
   04725 Cholinergic synapse
    100051499 (GNG11)
   04728 Dopaminergic synapse
    100051499 (GNG11)
   04726 Serotonergic synapse
    100051499 (GNG11)
   04723 Retrograde endocannabinoid signaling
    100051499 (GNG11)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100051499 (GNG11)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100051499 (GNG11)
  09165 Substance dependence
   05032 Morphine addiction
    100051499 (GNG11)
   05034 Alcoholism
    100051499 (GNG11)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100051499 (GNG11)
   05163 Human cytomegalovirus infection
    100051499 (GNG11)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100051499 (GNG11)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:ecb04031]
    100051499 (GNG11)
GTP-binding proteins [BR:ecb04031]
 Heterotrimeric G-proteins
  Gamma Subunits
   Gamma [OT]
    100051499 (GNG11)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: G-gamma HAUS5 DUF2508 COG2 Macoilin Cep57_CLD_2
Motif
Other DBs
NCBI-GeneID: 100051499
NCBI-ProteinID: XP_001492868
Ensembl: ENSECAG00000024185
VGNC: 18428
UniProt: F6X563
Position
4
AA seq 73 aa AA seqDB search
MPALHIEDLPEKEKLKMEVEQLRKEVKLQRQQVSKCSEEIKNYIEERSGEDPLVKGIPED
KNPFKEKGSCVIS
NT seq 222 nt NT seq  +upstreamnt  +downstreamnt
atgccggcccttcacatcgaagatttgccagaaaaggaaaagctgaagatggaagttgag
caacttcgcaaggaggtgaagttgcagagacaacaggtgtctaaatgttctgaagaaata
aagaattacattgaagaacgttctggagaggatcctctggtgaaaggaattccagaagac
aagaatccctttaaagaaaaaggcagctgcgttatttcataa

KEGG   Equus caballus (horse): 100052560Help
Entry
100052560         CDS       T01058                                 

Gene name
GNB3
Definition
(RefSeq) guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-3 isoform X2
  KO
K07825  guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-3
Organism
ecb  Equus caballus (horse)
Pathway
ecb04014  Ras signaling pathway
ecb04062  Chemokine signaling pathway
ecb04151  PI3K-Akt signaling pathway
ecb04371  Apelin signaling pathway
ecb04713  Circadian entrainment
ecb04723  Retrograde endocannabinoid signaling
ecb04724  Glutamatergic synapse
ecb04725  Cholinergic synapse
ecb04726  Serotonergic synapse
ecb04727  GABAergic synapse
ecb04728  Dopaminergic synapse
ecb04742  Taste transduction
ecb04926  Relaxin signaling pathway
ecb05032  Morphine addiction
ecb05034  Alcoholism
ecb05163  Human cytomegalovirus infection
ecb05167  Kaposi sarcoma-associated herpesvirus infection
ecb05170  Human immunodeficiency virus 1 infection
ecb05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    100052560 (GNB3)
   04371 Apelin signaling pathway
    100052560 (GNB3)
   04151 PI3K-Akt signaling pathway
    100052560 (GNB3)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    100052560 (GNB3)
  09152 Endocrine system
   04926 Relaxin signaling pathway
    100052560 (GNB3)
  09156 Nervous system
   04724 Glutamatergic synapse
    100052560 (GNB3)
   04727 GABAergic synapse
    100052560 (GNB3)
   04725 Cholinergic synapse
    100052560 (GNB3)
   04728 Dopaminergic synapse
    100052560 (GNB3)
   04726 Serotonergic synapse
    100052560 (GNB3)
   04723 Retrograde endocannabinoid signaling
    100052560 (GNB3)
  09157 Sensory system
   04742 Taste transduction
    100052560 (GNB3)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100052560 (GNB3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100052560 (GNB3)
  09165 Substance dependence
   05032 Morphine addiction
    100052560 (GNB3)
   05034 Alcoholism
    100052560 (GNB3)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100052560 (GNB3)
   05163 Human cytomegalovirus infection
    100052560 (GNB3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100052560 (GNB3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ecb04147]
    100052560 (GNB3)
   04031 GTP-binding proteins [BR:ecb04031]
    100052560 (GNB3)
Exosome [BR:ecb04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   100052560 (GNB3)
GTP-binding proteins [BR:ecb04031]
 Heterotrimeric G-proteins
  Beta Subunits
   Beta [OT]
    100052560 (GNB3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: WD40 ANAPC4_WD40 eIF2A WD40_like DUF5320 CALM_bind Myc-LZ Cytochrom_D1
Motif
Other DBs
NCBI-GeneID: 100052560
NCBI-ProteinID: XP_014596039
Ensembl: ENSECAG00000012522
VGNC: 18426
Position
6
AA seq 388 aa AA seqDB search
MSPFLVVGSNPHEESGVGCEGQKRGRGAPPTPTPCSWQEPESPLNPSAMGEMEQLRQEAE
QLKKQIADARKACADITLAELVSGLEVVGRVQMRTRRTLRGHLAKIYAMHWATDSKLLVS
ASQDGKLIVWDTYTTNKVHAIPLRSSWVMTCAYAPSGNFVACGGLDNMCSIYSLKSREGN
VKVSRELSAHTGYLSCCRFLDDNNIVTSSGDTTCALWDIETGQQKTVFVGHTGDCMSLAV
SPDFKLFISGACDASAKLWDVREGTCRQTFTGHESDINAICFFPNGEAICTGSDDASCRL
FDLRADQELTAYSHESIICGITSVAFSLSGRLLFAGYDDFNCNVWDSIKCERVGTLSGHD
NRVSCLGVTADGMAVATGSWDSFLKIWN
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgtccccatttcttgtagtgggctccaaccctcatgaggagtctggtgtggggtgtgag
ggacagaaacgtggccggggggctccccctacacctactccatgttcctggcaggagccg
gagtcacccctcaacccgtcagccatgggggagatggagcagctgcggcaggaagcggag
cagctcaagaagcagattgcagacgccaggaaagcctgtgctgacattactctggcagag
ctggtgtctggcctagaggtcgtgggacgagtccagatgcggacacggcggacgttacga
ggacacctggccaagatctatgccatgcactgggccactgactccaagctgctggtaagt
gcctcgcaagatgggaagctgatcgtgtgggacacctataccaccaataaggttcatgcc
atcccgctgcgctcctcctgggtcatgacctgtgcctatgccccgtcagggaattttgtg
gcatgtggggggctggacaacatgtgctccatctacagcctcaaatcccgcgagggcaat
gtcaaggtcagccgggagctctctgctcacacaggttatctctcctgctgccgcttcctg
gacgacaacaacattgtgaccagctcaggggacaccacgtgtgctctgtgggacattgag
actgggcagcagaagacagtgtttgtgggacacacgggggactgcatgagtctcgctgta
tctcctgacttcaaactcttcatttcgggggcctgtgacgccagcgccaagctctgggat
gtgcgggaggggacctgccggcagactttcactggccatgaatcggacatcaatgctatc
tgcttcttccccaatggagaggccatctgcacgggctcggacgacgcctcctgccgcctg
tttgacctgcgggccgaccaggagctgaccgcatactcccatgagagcatcatctgcggc
atcacgtccgtggccttctccctcagcggccgcctgctctttgcaggctatgatgacttc
aactgcaatgtctgggactccatcaagtgcgagcgcgtgggcaccctctctggccacgac
aacagggtcagctgcctgggggtcacagctgatgggatggctgtagccactggttcctgg
gacagcttcctcaaaatctggaactga

KEGG   Equus caballus (horse): 100055673Help
Entry
100055673         CDS       T01058                                 

Gene name
GNAI1
Definition
(RefSeq) guanine nucleotide-binding protein G(i) subunit alpha-1
  KO
K04630  guanine nucleotide-binding protein G(i) subunit alpha
Organism
ecb  Equus caballus (horse)
Pathway
ecb04015  Rap1 signaling pathway
ecb04022  cGMP-PKG signaling pathway
ecb04024  cAMP signaling pathway
ecb04062  Chemokine signaling pathway
ecb04071  Sphingolipid signaling pathway
ecb04261  Adrenergic signaling in cardiomyocytes
ecb04360  Axon guidance
ecb04371  Apelin signaling pathway
ecb04540  Gap junction
ecb04611  Platelet activation
ecb04670  Leukocyte transendothelial migration
ecb04713  Circadian entrainment
ecb04723  Retrograde endocannabinoid signaling
ecb04724  Glutamatergic synapse
ecb04725  Cholinergic synapse
ecb04726  Serotonergic synapse
ecb04727  GABAergic synapse
ecb04728  Dopaminergic synapse
ecb04730  Long-term depression
ecb04914  Progesterone-mediated oocyte maturation
ecb04915  Estrogen signaling pathway
ecb04916  Melanogenesis
ecb04921  Oxytocin signaling pathway
ecb04923  Regulation of lipolysis in adipocytes
ecb04924  Renin secretion
ecb04926  Relaxin signaling pathway
ecb04928  Parathyroid hormone synthesis, secretion and action
ecb04934  Cushing syndrome
ecb04935  Growth hormone synthesis, secretion and action
ecb04971  Gastric acid secretion
ecb05012  Parkinson disease
ecb05030  Cocaine addiction
ecb05032  Morphine addiction
ecb05034  Alcoholism
ecb05133  Pertussis
ecb05142  Chagas disease (American trypanosomiasis)
ecb05145  Toxoplasmosis
ecb05163  Human cytomegalovirus infection
ecb05170  Human immunodeficiency virus 1 infection
ecb05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    100055673 (GNAI1)
   04371 Apelin signaling pathway
    100055673 (GNAI1)
   04071 Sphingolipid signaling pathway
    100055673 (GNAI1)
   04024 cAMP signaling pathway
    100055673 (GNAI1)
   04022 cGMP-PKG signaling pathway
    100055673 (GNAI1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    100055673 (GNAI1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100055673 (GNAI1)
   04670 Leukocyte transendothelial migration
    100055673 (GNAI1)
   04062 Chemokine signaling pathway
    100055673 (GNAI1)
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocytes
    100055673 (GNAI1)
   04915 Estrogen signaling pathway
    100055673 (GNAI1)
   04914 Progesterone-mediated oocyte maturation
    100055673 (GNAI1)
   04921 Oxytocin signaling pathway
    100055673 (GNAI1)
   04926 Relaxin signaling pathway
    100055673 (GNAI1)
   04935 Growth hormone synthesis, secretion and action
    100055673 (GNAI1)
   04928 Parathyroid hormone synthesis, secretion and action
    100055673 (GNAI1)
   04916 Melanogenesis
    100055673 (GNAI1)
   04924 Renin secretion
    100055673 (GNAI1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100055673 (GNAI1)
  09154 Digestive system
   04971 Gastric acid secretion
    100055673 (GNAI1)
  09156 Nervous system
   04724 Glutamatergic synapse
    100055673 (GNAI1)
   04727 GABAergic synapse
    100055673 (GNAI1)
   04725 Cholinergic synapse
    100055673 (GNAI1)
   04728 Dopaminergic synapse
    100055673 (GNAI1)
   04726 Serotonergic synapse
    100055673 (GNAI1)
   04730 Long-term depression
    100055673 (GNAI1)
   04723 Retrograde endocannabinoid signaling
    100055673 (GNAI1)
  09158 Development and regeneration
   04360 Axon guidance
    100055673 (GNAI1)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100055673 (GNAI1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100055673 (GNAI1)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    100055673 (GNAI1)
  09165 Substance dependence
   05030 Cocaine addiction
    100055673 (GNAI1)
   05032 Morphine addiction
    100055673 (GNAI1)
   05034 Alcoholism
    100055673 (GNAI1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100055673 (GNAI1)
  09171 Infectious disease: bacterial
   05133 Pertussis
    100055673 (GNAI1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100055673 (GNAI1)
   05163 Human cytomegalovirus infection
    100055673 (GNAI1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100055673 (GNAI1)
   05142 Chagas disease (American trypanosomiasis)
    100055673 (GNAI1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ecb04147]
    100055673 (GNAI1)
   04031 GTP-binding proteins [BR:ecb04031]
    100055673 (GNAI1)
Exosome [BR:ecb04147]
 Exosomal proteins
  Proteins found in most exosomes
   100055673 (GNAI1)
GTP-binding proteins [BR:ecb04031]
 Heterotrimeric G-proteins
  Alpha Subunits
   Alpha type 1 (Gi/o) [OT]
    100055673 (GNAI1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: G-alpha Arf Gtr1_RagA Roc TniB AAA_16 AAA_29 FtsK_SpoIIIE
Motif
Other DBs
NCBI-GeneID: 100055673
NCBI-ProteinID: XP_023494588
Ensembl: ENSECAG00000000229
VGNC: 18415
Position
4
AA seq 354 aa AA seqDB search
MGCTLSAEDKAAVERSKMIDRNLREDGEKAAREVKLLLLGAGESGKSTIVKQMKIIHEAG
YSEEECKQYRAVVYSNTIQSIIAIIRAMGRLKIDFGDSARADDARQLFVLAGAAEEGFMT
AELAGVIKRLWKDSGVQACFNRSREYQLNDSAAYYLNDLDRIAQTNYIPTQQDVLRTRVK
TTGIVETHFTFKDLHFKMFDVGGQRSERKKWIHCFEGVTAIIFCVALSDYDLVLAEDEEM
NRMHESMKLFDSICNNKWFTDTSIILFLNKKDLFEEKIKKSALTICYPEYAGSNTYEEAA
AYIQCQFEELNKRKDTKEIYTHFTCATDTKNVQFVFDAVTDVIIKNNLKDCGLF
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgggctgcacgctgagcgccgaggacaaggcggcggtggagcgcagcaagatgatcgac
cgcaacctgcgcgaggacggcgagaaggcggcgcgcgaggtcaagctgctgctgctcggt
gctggtgaatctgggaaaagcaccattgtgaagcagatgaagatcatccacgaagccggt
tattcggaagaggagtgtaaacagtacagagctgtggtatacagcaacaccatccagtcc
atcattgccatcatcagggccatgggccggctcaagatagacttcggcgactcagcgcgg
gcggatgatgcccgccagctcttcgtgctcgcgggggccgctgaggaaggtttcatgacg
gcggagctggccggggttataaagaggttgtggaaagacagcggtgtgcaggcctgtttc
aacagatcccgcgagtaccagctcaacgattccgcagcatactacctgaatgacttggac
agaatagcacaaacaaattacatccccactcaacaagacgttctcagaactagagtgaaa
actacaggaatcgttgaaacccattttactttcaaagatcttcattttaaaatgtttgat
gtgggaggacagaggtccgagcggaagaaatggatccactgcttcgaaggcgtgaccgcc
atcatcttctgtgtggcgctgagcgactacgacctggttctggccgaagacgaagagatg
aatcggatgcacgaaagcatgaagttgttcgacagcatatgtaacaacaaatggtttaca
gacacttctattatcctttttctaaacaagaaggatctctttgaggagaaaatcaagaag
agtgccctcaccatatgctatccggaatatgcaggctcgaacacgtatgaagaggcagcc
gcatacatccagtgtcagtttgaagagctcaataagagaaaggacacgaaggagatatac
acccacttcacgtgtgccaccgacacgaagaacgtgcagttcgttttcgacgccgtaacg
gatgtcatcataaaaaataacctgaaggattgtggtctcttctga

KEGG   Equus caballus (horse): 100058238Help
Entry
100058238         CDS       T01058                                 

Gene name
GNAI3
Definition
(RefSeq) guanine nucleotide-binding protein G(k) subunit alpha
  KO
K04630  guanine nucleotide-binding protein G(i) subunit alpha
Organism
ecb  Equus caballus (horse)
Pathway
ecb04015  Rap1 signaling pathway
ecb04022  cGMP-PKG signaling pathway
ecb04024  cAMP signaling pathway
ecb04062  Chemokine signaling pathway
ecb04071  Sphingolipid signaling pathway
ecb04261  Adrenergic signaling in cardiomyocytes
ecb04360  Axon guidance
ecb04371  Apelin signaling pathway
ecb04540  Gap junction
ecb04611  Platelet activation
ecb04670  Leukocyte transendothelial migration
ecb04713  Circadian entrainment
ecb04723  Retrograde endocannabinoid signaling
ecb04724  Glutamatergic synapse
ecb04725  Cholinergic synapse
ecb04726  Serotonergic synapse
ecb04727  GABAergic synapse
ecb04728  Dopaminergic synapse
ecb04730  Long-term depression
ecb04914  Progesterone-mediated oocyte maturation
ecb04915  Estrogen signaling pathway
ecb04916  Melanogenesis
ecb04921  Oxytocin signaling pathway
ecb04923  Regulation of lipolysis in adipocytes
ecb04924  Renin secretion
ecb04926  Relaxin signaling pathway
ecb04928  Parathyroid hormone synthesis, secretion and action
ecb04934  Cushing syndrome
ecb04935  Growth hormone synthesis, secretion and action
ecb04971  Gastric acid secretion
ecb05012  Parkinson disease
ecb05030  Cocaine addiction
ecb05032  Morphine addiction
ecb05034  Alcoholism
ecb05133  Pertussis
ecb05142  Chagas disease (American trypanosomiasis)
ecb05145  Toxoplasmosis
ecb05163  Human cytomegalovirus infection
ecb05170  Human immunodeficiency virus 1 infection
ecb05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    100058238 (GNAI3)
   04371 Apelin signaling pathway
    100058238 (GNAI3)
   04071 Sphingolipid signaling pathway
    100058238 (GNAI3)
   04024 cAMP signaling pathway
    100058238 (GNAI3)
   04022 cGMP-PKG signaling pathway
    100058238 (GNAI3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    100058238 (GNAI3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100058238 (GNAI3)
   04670 Leukocyte transendothelial migration
    100058238 (GNAI3)
   04062 Chemokine signaling pathway
    100058238 (GNAI3)
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocytes
    100058238 (GNAI3)
   04915 Estrogen signaling pathway
    100058238 (GNAI3)
   04914 Progesterone-mediated oocyte maturation
    100058238 (GNAI3)
   04921 Oxytocin signaling pathway
    100058238 (GNAI3)
   04926 Relaxin signaling pathway
    100058238 (GNAI3)
   04935 Growth hormone synthesis, secretion and action
    100058238 (GNAI3)
   04928 Parathyroid hormone synthesis, secretion and action
    100058238 (GNAI3)
   04916 Melanogenesis
    100058238 (GNAI3)
   04924 Renin secretion
    100058238 (GNAI3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100058238 (GNAI3)
  09154 Digestive system
   04971 Gastric acid secretion
    100058238 (GNAI3)
  09156 Nervous system
   04724 Glutamatergic synapse
    100058238 (GNAI3)
   04727 GABAergic synapse
    100058238 (GNAI3)
   04725 Cholinergic synapse
    100058238 (GNAI3)
   04728 Dopaminergic synapse
    100058238 (GNAI3)
   04726 Serotonergic synapse
    100058238 (GNAI3)
   04730 Long-term depression
    100058238 (GNAI3)
   04723 Retrograde endocannabinoid signaling
    100058238 (GNAI3)
  09158 Development and regeneration
   04360 Axon guidance
    100058238 (GNAI3)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100058238 (GNAI3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100058238 (GNAI3)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    100058238 (GNAI3)
  09165 Substance dependence
   05030 Cocaine addiction
    100058238 (GNAI3)
   05032 Morphine addiction
    100058238 (GNAI3)
   05034 Alcoholism
    100058238 (GNAI3)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100058238 (GNAI3)
  09171 Infectious disease: bacterial
   05133 Pertussis
    100058238 (GNAI3)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100058238 (GNAI3)
   05163 Human cytomegalovirus infection
    100058238 (GNAI3)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100058238 (GNAI3)
   05142 Chagas disease (American trypanosomiasis)
    100058238 (GNAI3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ecb04147]
    100058238 (GNAI3)
   04031 GTP-binding proteins [BR:ecb04031]
    100058238 (GNAI3)
Exosome [BR:ecb04147]
 Exosomal proteins
  Proteins found in most exosomes
   100058238 (GNAI3)
GTP-binding proteins [BR:ecb04031]
 Heterotrimeric G-proteins
  Alpha Subunits
   Alpha type 1 (Gi/o) [OT]
    100058238 (GNAI3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: G-alpha Arf Gtr1_RagA Roc TniB AAA_29 FtsK_SpoIIIE AAA_16
Motif
Other DBs
NCBI-GeneID: 100058238
NCBI-ProteinID: XP_023497233
VGNC: 50840
Position
5
AA seq 354 aa AA seqDB search
MGCTLSAEDKAAVERSKMIDRNLREDGEKAAKEVKLLLLGAGESGKSTIVKQMKIIHEDG
YSEEECKQYKVVVYSNTIQSIIAIIRAMGRLKIDFGEAARADDARQLFVLAGSAEEGVMT
PELAGVIKRLWRDGGVQACFSRSREYQLNDSASYYLNDLDRISQSNYIPTQQDVLRTRVK
TTGIVETHFTFKDLYFKMFDVGGQRSERKKWIHCFEGVTAIIFCVALSDYDLVLAEDEEM
NRMHESMKLFDSICNNKWFTDTSIILFLNKKDLFEEKIKRSPLTICYPEYTGSNTYEEAA
AYIQCQFEDLNRRKDTKEIYTHFTCATDTKNVQFVFDAVTDVIIKNNLKECGLY
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgggctgcacactgagcgccgaagacaaggcggcggtggagcggagcaagatgatcgac
cgcaacttgcgggaggacggagagaaagcggccaaagaagtgaagctgctgctcctcggt
gctggagaatctggtaaaagcactatcgtgaaacagatgaaaatcattcatgaggacggc
tattcagaggaagaatgtaaacaatataaagtagttgtctacagcaatactatacagtcc
atcattgcaatcataagagccatgggacggctaaagattgactttggagaagctgccaga
gcagatgatgcccggcaattatttgttttagctggcagtgctgaagaaggagtcatgact
ccagaactagcaggagtgattaaacggttatggcgagatggtggggtgcaagcttgcttc
agcagatctagggaatatcagctcaatgattctgcttcatattacctaaatgatttggat
agaatatcccaaagcaactacattccaacccagcaagatgtcctgcggacaagagtgaag
accacaggcattgtggaaacgcatttcaccttcaaagacctatacttcaagatgtttgat
gtaggtggccaaagatcagaacgaaaaaagtggattcactgttttgagggagtgacagca
attatcttctgtgtggccctcagtgattatgaccttgttctggctgaggatgaggagatg
aaccgaatgcatgaaagcatgaaactgtttgacagcatttgtaataacaaatggtttaca
gacacttcaatcattctcttcctcaacaagaaagacctttttgaggaaaaaataaagagg
agtccgttaactatctgttatccagaatacacaggttccaatacatatgaagaagcagct
gcttacattcagtgccagtttgaagatctgaacagaagaaaagataccaaggagatctac
actcacttcacctgtgccacggacaccaagaatgtacagtttgtttttgatgctgttaca
gatgtcatcattaaaaacaacttaaaggaatgtggactttattga

KEGG   Equus caballus (horse): 100058274Help
Entry
100058274         CDS       T01058                                 

Gene name
GNB4
Definition
(RefSeq) guanine nucleotide-binding protein subunit beta-4
  KO
K04538  guanine nucleotide-binding protein subunit beta-4
Organism
ecb  Equus caballus (horse)
Pathway
ecb04014  Ras signaling pathway
ecb04062  Chemokine signaling pathway
ecb04151  PI3K-Akt signaling pathway
ecb04371  Apelin signaling pathway
ecb04713  Circadian entrainment
ecb04723  Retrograde endocannabinoid signaling
ecb04724  Glutamatergic synapse
ecb04725  Cholinergic synapse
ecb04726  Serotonergic synapse
ecb04727  GABAergic synapse
ecb04728  Dopaminergic synapse
ecb04926  Relaxin signaling pathway
ecb05032  Morphine addiction
ecb05034  Alcoholism
ecb05163  Human cytomegalovirus infection
ecb05167  Kaposi sarcoma-associated herpesvirus infection
ecb05170  Human immunodeficiency virus 1 infection
ecb05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    100058274 (GNB4)
   04371 Apelin signaling pathway
    100058274 (GNB4)
   04151 PI3K-Akt signaling pathway
    100058274 (GNB4)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    100058274 (GNB4)
  09152 Endocrine system
   04926 Relaxin signaling pathway
    100058274 (GNB4)
  09156 Nervous system
   04724 Glutamatergic synapse
    100058274 (GNB4)
   04727 GABAergic synapse
    100058274 (GNB4)
   04725 Cholinergic synapse
    100058274 (GNB4)
   04728 Dopaminergic synapse
    100058274 (GNB4)
   04726 Serotonergic synapse
    100058274 (GNB4)
   04723 Retrograde endocannabinoid signaling
    100058274 (GNB4)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100058274 (GNB4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100058274 (GNB4)
  09165 Substance dependence
   05032 Morphine addiction
    100058274 (GNB4)
   05034 Alcoholism
    100058274 (GNB4)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100058274 (GNB4)
   05163 Human cytomegalovirus infection
    100058274 (GNB4)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100058274 (GNB4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ecb04147]
    100058274 (GNB4)
   04031 GTP-binding proteins [BR:ecb04031]
    100058274 (GNB4)
Exosome [BR:ecb04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   100058274 (GNB4)
GTP-binding proteins [BR:ecb04031]
 Heterotrimeric G-proteins
  Beta Subunits
   Beta [OT]
    100058274 (GNB4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: WD40 ANAPC4_WD40 eIF2A WD40_like
Motif
Other DBs
NCBI-GeneID: 100058274
NCBI-ProteinID: XP_023479105
Ensembl: ENSECAG00000008196
VGNC: 18427
Position
19
AA seq 340 aa AA seqDB search
MSELEQLRQEAEQLRNQIQDARKACNDATLIQITSNMDSVGRIQMRTRRTLRGHLAKIYA
MHWGYDSRLLVSASQDGKLIIWDSYTTNKMHAIPLRSSWVMTCAYAPSGNYVACGGLDNI
CSIYNLKTREGNVRVSRELPGHTGYLSCCRFLDDSQIVTSSGDTTCALWDIETAQQTTMF
TGHSGDVMSLSLSPDMRTFVSGACDASSKLWDIRDGMCRQSFTGHVSDINAVSFFPNGYA
FATGSDDATCRLFDLRADQELLLYSHDNIICGITSVAFSKSGRLLLAGYDDFNCNVWDTL
KGDRAGVLAGHDNRVSCLGVTDDGMAVATGSWDSFLRIWN
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaactggaacagttgaggcaggaagccgaacaactgcggaatcagatccaggat
gccaggaaagcatgtaatgatgcaacgcttattcagatcacatcaaatatggattccgtg
ggtcgaatacaaatgcgaacgagacgtacgctgaggggtcacctagccaaaatctacgct
atgcactggggatatgattcaaggctactagtcagtgcttcccaagatggaaaattaatt
atttgggatagctatacaacaaataagatgcatgctattcctttgcgatcctcctgggtg
atgacctgtgcctatgctccctctggcaattacgttgcttgcggagggctggacaacatc
tgctccatatataacttaaaaaccagagagggaaatgtgagagtgagccgagagttacca
ggtcacacaggctacttgtcctgctgccgttttttagatgacagccaaattgttacaagt
tcaggagatacaacttgtgctttatgggacatcgaaactgcccagcagaccaccatgttc
actgggcattctggagatgtgatgagtctttccctgagtcccgacatgaggacttttgtt
tctggtgcttgtgacgcctcttccaagttatgggatattcgagatggaatgtgtagacag
tctttcactggacacgtgtcggatattaatgctgtcagttttttcccaaatggctatgcc
tttgccaccggctctgatgatgccacttgccggctcttcgaccttcgtgcagaccaagag
ttgttactgtattcccatgacaacatcatctgtggaatcacttccgtagccttctcaaaa
agtgggcgcctcctgttagctggttatgacgactttaattgtaacgtatgggacacgcta
aaaggagatcgtgcaggtgtccttgctggtcatgacaaccgtgtcagctgcttgggtgta
actgatgatggcatggctgtggccacaggctcctgggacagttttcttagaatctggaat
taa

KEGG   Equus caballus (horse): 100058605Help
Entry
100058605         CDS       T01058                                 

Gene name
GNG4
Definition
(RefSeq) guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-4
  KO
K04541  guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-4
Organism
ecb  Equus caballus (horse)
Pathway
ecb04014  Ras signaling pathway
ecb04062  Chemokine signaling pathway
ecb04151  PI3K-Akt signaling pathway
ecb04371  Apelin signaling pathway
ecb04713  Circadian entrainment
ecb04723  Retrograde endocannabinoid signaling
ecb04724  Glutamatergic synapse
ecb04725  Cholinergic synapse
ecb04726  Serotonergic synapse
ecb04727  GABAergic synapse
ecb04728  Dopaminergic synapse
ecb04926  Relaxin signaling pathway
ecb05032  Morphine addiction
ecb05034  Alcoholism
ecb05163  Human cytomegalovirus infection
ecb05167  Kaposi sarcoma-associated herpesvirus infection
ecb05170  Human immunodeficiency virus 1 infection
ecb05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    100058605 (GNG4)
   04371 Apelin signaling pathway
    100058605 (GNG4)
   04151 PI3K-Akt signaling pathway
    100058605 (GNG4)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    100058605 (GNG4)
  09152 Endocrine system
   04926 Relaxin signaling pathway
    100058605 (GNG4)
  09156 Nervous system
   04724 Glutamatergic synapse
    100058605 (GNG4)
   04727 GABAergic synapse
    100058605 (GNG4)
   04725 Cholinergic synapse
    100058605 (GNG4)
   04728 Dopaminergic synapse
    100058605 (GNG4)
   04726 Serotonergic synapse
    100058605 (GNG4)
   04723 Retrograde endocannabinoid signaling
    100058605 (GNG4)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100058605 (GNG4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100058605 (GNG4)
  09165 Substance dependence
   05032 Morphine addiction
    100058605 (GNG4)
   05034 Alcoholism
    100058605 (GNG4)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100058605 (GNG4)
   05163 Human cytomegalovirus infection
    100058605 (GNG4)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100058605 (GNG4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:ecb04031]
    100058605 (GNG4)
GTP-binding proteins [BR:ecb04031]
 Heterotrimeric G-proteins
  Gamma Subunits
   Gamma [OT]
    100058605 (GNG4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: G-gamma
Motif
Other DBs
NCBI-GeneID: 100058605
NCBI-ProteinID: XP_023502871
Ensembl: ENSECAG00000012185
VGNC: 18433
Position
1
AA seq 75 aa AA seqDB search
MKEGMSNNSTTSISQARKAVEQLKMEACMDRVKVSQAAADLLAYCEAHVREDPLVTPVPA
SENPFREKKFFCTIL
NT seq 228 nt NT seq  +upstreamnt  +downstreamnt
atgaaagagggcatgtccaacaacagcaccactagcatctcccaagccaggaaggctgtg
gagcagctgaagatggaagcctgtatggacagagtgaaggtctcccaggccgctgccgac
ctcctggcgtactgtgaagcccacgtgcgggaagaccccctcgtcaccccagtgcctgcg
tcagaaaaccccttccgagagaagaagttcttctgcaccattctctga

KEGG   Equus caballus (horse): 100059736Help
Entry
100059736         CDS       T01058                                 

Gene name
GNG7
Definition
(RefSeq) guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-7
  KO
K04543  guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-7
Organism
ecb  Equus caballus (horse)
Pathway
ecb04014  Ras signaling pathway
ecb04062  Chemokine signaling pathway
ecb04151  PI3K-Akt signaling pathway
ecb04371  Apelin signaling pathway
ecb04713  Circadian entrainment
ecb04723  Retrograde endocannabinoid signaling
ecb04724  Glutamatergic synapse
ecb04725  Cholinergic synapse
ecb04726  Serotonergic synapse
ecb04727  GABAergic synapse
ecb04728  Dopaminergic synapse
ecb04740  Olfactory transduction
ecb04926  Relaxin signaling pathway
ecb05032  Morphine addiction
ecb05034  Alcoholism
ecb05163  Human cytomegalovirus infection
ecb05167  Kaposi sarcoma-associated herpesvirus infection
ecb05170  Human immunodeficiency virus 1 infection
ecb05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    100059736 (GNG7)
   04371 Apelin signaling pathway
    100059736 (GNG7)
   04151 PI3K-Akt signaling pathway
    100059736 (GNG7)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    100059736 (GNG7)
  09152 Endocrine system
   04926 Relaxin signaling pathway
    100059736 (GNG7)
  09156 Nervous system
   04724 Glutamatergic synapse
    100059736 (GNG7)
   04727 GABAergic synapse
    100059736 (GNG7)
   04725 Cholinergic synapse
    100059736 (GNG7)
   04728 Dopaminergic synapse
    100059736 (GNG7)
   04726 Serotonergic synapse
    100059736 (GNG7)
   04723 Retrograde endocannabinoid signaling
    100059736 (GNG7)
  09157 Sensory system
   04740 Olfactory transduction
    100059736 (GNG7)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100059736 (GNG7)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100059736 (GNG7)
  09165 Substance dependence
   05032 Morphine addiction
    100059736 (GNG7)
   05034 Alcoholism
    100059736 (GNG7)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100059736 (GNG7)
   05163 Human cytomegalovirus infection
    100059736 (GNG7)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100059736 (GNG7)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ecb04147]
    100059736 (GNG7)
   04031 GTP-binding proteins [BR:ecb04031]
    100059736 (GNG7)
Exosome [BR:ecb04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100059736 (GNG7)
  Exosomal proteins of other body fluids (saliva and urine)
   100059736 (GNG7)
GTP-binding proteins [BR:ecb04031]
 Heterotrimeric G-proteins
  Gamma Subunits
   Gamma [OT]
    100059736 (GNG7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: G-gamma FtsX_ECD CP12
Motif
Other DBs
NCBI-GeneID: 100059736
NCBI-ProteinID: XP_023500144
Ensembl: ENSECAG00000011705
VGNC: 18435
Position
7
AA seq 68 aa AA seqDB search
MSATNNIAQARKLVEQLRIEAGIERIKVSKASSELMSYCEQHARNDPLLVGVPASENPFK
DKKPCIIL
NT seq 207 nt NT seq  +upstreamnt  +downstreamnt
atgtcagccactaacaacatagcgcaggcccggaagctggtggaacagctgcggatcgaa
gccgggatcgagcgcatcaaggtctccaaagcctcgtcggaactcatgagctactgtgag
cagcacgcccgcaacgaccccctgctggtcggcgtccctgcctccgagaatccctttaag
gacaagaagccgtgtattatcctatag

KEGG   Equus caballus (horse): 100061395Help
Entry
100061395         CDS       T01058                                 

Gene name
GNB1
Definition
(RefSeq) guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1
  KO
K04536  guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1
Organism
ecb  Equus caballus (horse)
Pathway
ecb04014  Ras signaling pathway
ecb04062  Chemokine signaling pathway
ecb04151  PI3K-Akt signaling pathway
ecb04371  Apelin signaling pathway
ecb04713  Circadian entrainment
ecb04723  Retrograde endocannabinoid signaling
ecb04724  Glutamatergic synapse
ecb04725  Cholinergic synapse
ecb04726  Serotonergic synapse
ecb04727  GABAergic synapse
ecb04728  Dopaminergic synapse
ecb04740  Olfactory transduction
ecb04744  Phototransduction
ecb04926  Relaxin signaling pathway
ecb05032  Morphine addiction
ecb05034  Alcoholism
ecb05163  Human cytomegalovirus infection
ecb05167  Kaposi sarcoma-associated herpesvirus infection
ecb05170  Human immunodeficiency virus 1 infection
ecb05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    100061395 (GNB1)
   04371 Apelin signaling pathway
    100061395 (GNB1)
   04151 PI3K-Akt signaling pathway
    100061395 (GNB1)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    100061395 (GNB1)
  09152 Endocrine system
   04926 Relaxin signaling pathway
    100061395 (GNB1)
  09156 Nervous system
   04724 Glutamatergic synapse
    100061395 (GNB1)
   04727 GABAergic synapse
    100061395 (GNB1)
   04725 Cholinergic synapse
    100061395 (GNB1)
   04728 Dopaminergic synapse
    100061395 (GNB1)
   04726 Serotonergic synapse
    100061395 (GNB1)
   04723 Retrograde endocannabinoid signaling
    100061395 (GNB1)
  09157 Sensory system
   04744 Phototransduction
    100061395 (GNB1)
   04740 Olfactory transduction
    100061395 (GNB1)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100061395 (GNB1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100061395 (GNB1)
  09165 Substance dependence
   05032 Morphine addiction
    100061395 (GNB1)
   05034 Alcoholism
    100061395 (GNB1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100061395 (GNB1)
   05163 Human cytomegalovirus infection
    100061395 (GNB1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100061395 (GNB1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ecb04147]
    100061395 (GNB1)
   04031 GTP-binding proteins [BR:ecb04031]
    100061395 (GNB1)
Exosome [BR:ecb04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100061395 (GNB1)
  Exosomal proteins of colorectal cancer cells
   100061395 (GNB1)
  Exosomal proteins of melanoma cells
   100061395 (GNB1)
GTP-binding proteins [BR:ecb04031]
 Heterotrimeric G-proteins
  Beta Subunits
   Beta [OT]
    100061395 (GNB1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: WD40 ANAPC4_WD40 WD40_like eIF2A Myc-LZ CALM_bind
Motif
Other DBs
NCBI-GeneID: 100061395
NCBI-ProteinID: XP_023491739
Ensembl: ENSECAG00000021999
VGNC: 18423
Position
2
AA seq 340 aa AA seqDB search
MSELDQLRQEAEQLKNQIRDARKACADATLSQITNNIDPVGRIQMRTRRTLRGHLAKIYA
MHWGTDSRLLVSASQDGKLIIWDSYTTNKVHAIPLRSSWVMTCAYAPSGNYVACGGLDNI
CSIYNLKTREGNVRVSRELAGHTGYLSCCRFLDDNQIVTSSGDTTCALWDIETGQQTTTF
TGHTGDVMSLSLAPDARLFVSGACDASAKLWDVREGMCRQTFTGHESDINAICFFPNGNA
FATGSDDATCRLFDLRADQELMTYSHDNIICGITSVSFSKSGRLLLAGYDDFNCNVWDAL
KADRAGVLAGHDNRVSCLGVTDDGMAVATGSWDSFLKIWN
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaacttgaccagttacggcaggaggctgagcagcttaaaaaccaaattagagat
gccaggaaagcgtgtgcagatgcaactctttctcagatcacaaacaacatcgaccctgtg
ggaagaatccagatgcgcaccaggagaacgctgaggggacacttggccaagatttatgcc
atgcactggggcacggattccaggcttctagttagtgcttcacaggatggtaaacttatc
atctgggatagctacaccacaaacaaggtccatgccatccctctgcgctcctcgtgggtc
atgacctgtgcatacgccccttctgggaactatgtggcctgcggtggcctggataacatc
tgctccatttacaatctgaaaactcgtgaagggaatgtacgtgtgagccgtgaactggcc
ggacatacaggttacctgtcctgctgccgtttcctggatgacaatcagatcgtcaccagc
tctggagacaccacctgtgctctgtgggacatcgagaccggccagcagacgaccacgttc
actggacacaccggggatgttatgagcctttctctcgctcctgatgccagactgtttgtt
tctggtgcttgtgatgcttcagccaaactctgggatgtgcgagaagggatgtgccggcaa
actttcaccggccacgaatctgacatcaatgccatctgtttctttccaaatggcaacgca
tttgccactggctcagatgacgctacctgcaggctgtttgaccttcgtgcggatcaggag
ctcatgacttattcccatgacaacatcatatgtgggataacctccgtgtccttctccaag
agcgggcgcctcctcctcgcagggtacgacgacttcaactgcaacgtctgggacgcgctc
aaagccgacagggctggtgtcttggctgggcatgacaaccgtgtcagctgcctgggggtg
actgatgacgggatggccgtggcaacggggtcctgggacagcttcctcaagatctggaac
tag

KEGG   Equus caballus (horse): 100062085Help
Entry
100062085         CDS       T01058                                 

Gene name
GNAI2
Definition
(RefSeq) guanine nucleotide-binding protein G(i) subunit alpha-2
  KO
K04630  guanine nucleotide-binding protein G(i) subunit alpha
Organism
ecb  Equus caballus (horse)
Pathway
ecb04015  Rap1 signaling pathway
ecb04022  cGMP-PKG signaling pathway
ecb04024  cAMP signaling pathway
ecb04062  Chemokine signaling pathway
ecb04071  Sphingolipid signaling pathway
ecb04261  Adrenergic signaling in cardiomyocytes
ecb04360  Axon guidance
ecb04371  Apelin signaling pathway
ecb04540  Gap junction
ecb04611  Platelet activation
ecb04670  Leukocyte transendothelial migration
ecb04713  Circadian entrainment
ecb04723  Retrograde endocannabinoid signaling
ecb04724  Glutamatergic synapse
ecb04725  Cholinergic synapse
ecb04726  Serotonergic synapse
ecb04727  GABAergic synapse
ecb04728  Dopaminergic synapse
ecb04730  Long-term depression
ecb04914  Progesterone-mediated oocyte maturation
ecb04915  Estrogen signaling pathway
ecb04916  Melanogenesis
ecb04921  Oxytocin signaling pathway
ecb04923  Regulation of lipolysis in adipocytes
ecb04924  Renin secretion
ecb04926  Relaxin signaling pathway
ecb04928  Parathyroid hormone synthesis, secretion and action
ecb04934  Cushing syndrome
ecb04935  Growth hormone synthesis, secretion and action
ecb04971  Gastric acid secretion
ecb05012  Parkinson disease
ecb05030  Cocaine addiction
ecb05032  Morphine addiction
ecb05034  Alcoholism
ecb05133  Pertussis
ecb05142  Chagas disease (American trypanosomiasis)
ecb05145  Toxoplasmosis
ecb05163  Human cytomegalovirus infection
ecb05170  Human immunodeficiency virus 1 infection
ecb05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    100062085 (GNAI2)
   04371 Apelin signaling pathway
    100062085 (GNAI2)
   04071 Sphingolipid signaling pathway
    100062085 (GNAI2)
   04024 cAMP signaling pathway
    100062085 (GNAI2)
   04022 cGMP-PKG signaling pathway
    100062085 (GNAI2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    100062085 (GNAI2)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100062085 (GNAI2)
   04670 Leukocyte transendothelial migration
    100062085 (GNAI2)
   04062 Chemokine signaling pathway
    100062085 (GNAI2)
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocytes
    100062085 (GNAI2)
   04915 Estrogen signaling pathway
    100062085 (GNAI2)
   04914 Progesterone-mediated oocyte maturation
    100062085 (GNAI2)
   04921 Oxytocin signaling pathway
    100062085 (GNAI2)
   04926 Relaxin signaling pathway
    100062085 (GNAI2)
   04935 Growth hormone synthesis, secretion and action
    100062085 (GNAI2)
   04928 Parathyroid hormone synthesis, secretion and action
    100062085 (GNAI2)
   04916 Melanogenesis
    100062085 (GNAI2)
   04924 Renin secretion
    100062085 (GNAI2)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100062085 (GNAI2)
  09154 Digestive system
   04971 Gastric acid secretion
    100062085 (GNAI2)
  09156 Nervous system
   04724 Glutamatergic synapse
    100062085 (GNAI2)
   04727 GABAergic synapse
    100062085 (GNAI2)
   04725 Cholinergic synapse
    100062085 (GNAI2)
   04728 Dopaminergic synapse
    100062085 (GNAI2)
   04726 Serotonergic synapse
    100062085 (GNAI2)
   04730 Long-term depression
    100062085 (GNAI2)
   04723 Retrograde endocannabinoid signaling
    100062085 (GNAI2)
  09158 Development and regeneration
   04360 Axon guidance
    100062085 (GNAI2)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100062085 (GNAI2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100062085 (GNAI2)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    100062085 (GNAI2)
  09165 Substance dependence
   05030 Cocaine addiction
    100062085 (GNAI2)
   05032 Morphine addiction
    100062085 (GNAI2)
   05034 Alcoholism
    100062085 (GNAI2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100062085 (GNAI2)
  09171 Infectious disease: bacterial
   05133 Pertussis
    100062085 (GNAI2)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100062085 (GNAI2)
   05163 Human cytomegalovirus infection
    100062085 (GNAI2)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100062085 (GNAI2)
   05142 Chagas disease (American trypanosomiasis)
    100062085 (GNAI2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ecb04147]
    100062085 (GNAI2)
   04031 GTP-binding proteins [BR:ecb04031]
    100062085 (GNAI2)
Exosome [BR:ecb04147]
 Exosomal proteins
  Proteins found in most exosomes
   100062085 (GNAI2)
GTP-binding proteins [BR:ecb04031]
 Heterotrimeric G-proteins
  Alpha Subunits
   Alpha type 1 (Gi/o) [OT]
    100062085 (GNAI2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: G-alpha Arf Gtr1_RagA Roc AAA_16 TniB AAA_29
Motif
Other DBs
NCBI-GeneID: 100062085
NCBI-ProteinID: XP_023476151
Ensembl: ENSECAG00000000489
VGNC: 18416
Position
16
AA seq 355 aa AA seqDB search
MGCTVSAEDKAAAERSKMIDKNLREDGEKAAREVKLLLLGAGESGKSTIVKQMKIIHEDG
YSEEECRQYRAVVYSNTIQSIMAIVKAMGNLQIDFADPSRADDARQLFALSCTAEEQGVL
PEDLSGVIRRLWADHGVQACFGRSREYQLNDSAAYYLNDLERIAQSDYIPTQQDVLRTRV
KTTGIVETHFTFKDLHFKMFDVGGQRSERKKWIHCFEGVTAIIFCVALSAYDLVLAEDEE
MNRMHESMKLFDSICNNKWFTDTSIILFLNKKDLFEEKITHSPLTICFPEYTGANKYDEA
ASYIQSKFEDLNKRKDTKEIYTHFTCATDTKNVQFVFDAVTDVIIKNNLKDCGLF
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atgggctgcactgtgagcgccgaggacaaggcggcggccgagcgctccaagatgatcgac
aagaatctgcgggaagacggcgagaaagcggcgcgggaggtgaagttgctgctgttgggt
gctggggagtcaggaaagagcaccattgtcaagcagatgaagatcatccatgaggatggt
tactcagaggaggaatgccggcagtaccgggcagtcgtctacagcaacaccatccagtcc
atcatggccattgtcaaagccatgggcaatctgcagattgactttgccgacccctctcgt
gcggacgacgccaggcagctgtttgcgctctcctgcacggccgaggagcagggcgtgctc
cctgaggacctgtccggcgtcatccggaggctctgggctgaccatggtgtgcaggcctgc
tttggccgctctcgggagtaccagctcaacgactccgccgcctactacctgaacgacctg
gagcgcatcgcccagagtgactatatccccacacagcaggatgtgctacgaacccgcgtg
aagaccacaggcatcgtagagacacacttcaccttcaaggacctacacttcaagatgttt
gatgttggtggtcagcggtctgagcggaagaaatggatacactgctttgagggtgtcaca
gccatcatcttctgcgtagccttgagcgcctacgacctggtgctagctgaggatgaggag
atgaaccgcatgcacgagagcatgaagctgtttgacagtatctgcaacaacaagtggttc
acggacacgtccatcattctcttcctcaacaagaaggacctgtttgaggagaagatcaca
cacagccccctgaccatctgcttccccgagtacacaggggccaacaagtacgacgaagcg
gccagctacatccagagtaagtttgaagacctgaacaagcgcaaggacaccaaggaaatc
tacacgcacttcacgtgcgccaccgacaccaagaacgtgcagttcgtgtttgacgccgtc
accgacgtcatcatcaagaacaacctgaaggactgcggcctcttctga

KEGG   Equus caballus (horse): 100063518Help
Entry
100063518         CDS       T01058                                 

Gene name
GNG14
Definition
(RefSeq) putative guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-14
  KO
K04347  guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-12
Organism
ecb  Equus caballus (horse)
Pathway
ecb04010  MAPK signaling pathway
ecb04014  Ras signaling pathway
ecb04062  Chemokine signaling pathway
ecb04151  PI3K-Akt signaling pathway
ecb04371  Apelin signaling pathway
ecb04713  Circadian entrainment
ecb04723  Retrograde endocannabinoid signaling
ecb04724  Glutamatergic synapse
ecb04725  Cholinergic synapse
ecb04726  Serotonergic synapse
ecb04727  GABAergic synapse
ecb04728  Dopaminergic synapse
ecb04810  Regulation of actin cytoskeleton
ecb04926  Relaxin signaling pathway
ecb05032  Morphine addiction
ecb05034  Alcoholism
ecb05163  Human cytomegalovirus infection
ecb05167  Kaposi sarcoma-associated herpesvirus infection
ecb05170  Human immunodeficiency virus 1 infection
ecb05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    100063518 (GNG14)
   04010 MAPK signaling pathway
    100063518 (GNG14)
   04371 Apelin signaling pathway
    100063518 (GNG14)
   04151 PI3K-Akt signaling pathway
    100063518 (GNG14)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100063518 (GNG14)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    100063518 (GNG14)
  09152 Endocrine system
   04926 Relaxin signaling pathway
    100063518 (GNG14)
  09156 Nervous system
   04724 Glutamatergic synapse
    100063518 (GNG14)
   04727 GABAergic synapse
    100063518 (GNG14)
   04725 Cholinergic synapse
    100063518 (GNG14)
   04728 Dopaminergic synapse
    100063518 (GNG14)
   04726 Serotonergic synapse
    100063518 (GNG14)
   04723 Retrograde endocannabinoid signaling
    100063518 (GNG14)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100063518 (GNG14)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100063518 (GNG14)
  09165 Substance dependence
   05032 Morphine addiction
    100063518 (GNG14)
   05034 Alcoholism
    100063518 (GNG14)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100063518 (GNG14)
   05163 Human cytomegalovirus infection
    100063518 (GNG14)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100063518 (GNG14)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ecb04147]
    100063518 (GNG14)
   04031 GTP-binding proteins [BR:ecb04031]
    100063518 (GNG14)
Exosome [BR:ecb04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100063518 (GNG14)
  Exosomal proteins of colorectal cancer cells
   100063518 (GNG14)
GTP-binding proteins [BR:ecb04031]
 Heterotrimeric G-proteins
  Gamma Subunits
   Gamma [OT]
    100063518 (GNG14)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: G-gamma
Motif
Other DBs
NCBI-GeneID: 100063518
NCBI-ProteinID: XP_001504939
Position
7
AA seq 98 aa AA seqDB search
MLQSPLVFLLPAAVTSSGKPSLTFLWMSSKVAIGSDIGQARQAVEQLRMEAGIDRVKVSK
AATDLLQFCMEQAKSDPFLVGIPAATNPFKEKKPCAIL
NT seq 297 nt NT seq  +upstreamnt  +downstreamnt
atgctgcagagccctctggtcttccttcttccggcagctgtcacctcctctgggaagcct
tccctgaccttcctctggatgtccagcaaggtggccattggcagcgacattgggcaggcc
cgccaggctgtggaacagctgcggatggaggccggcatcgaccgcgtcaaggtgtccaag
gcagccaccgacctgctacagttctgcatggagcaagccaagagtgaccccttcctcgtg
ggcatcccggctgccaccaaccccttcaaggagaagaagccctgcgccatcctatga

KEGG   Equus caballus (horse): 100063795Help
Entry
100063795         CDS       T01058                                 

Gene name
GNG3
Definition
(RefSeq) guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-3
  KO
K04540  guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-3
Organism
ecb  Equus caballus (horse)
Pathway
ecb04014  Ras signaling pathway
ecb04062  Chemokine signaling pathway
ecb04151  PI3K-Akt signaling pathway
ecb04371  Apelin signaling pathway
ecb04713  Circadian entrainment
ecb04723  Retrograde endocannabinoid signaling
ecb04724  Glutamatergic synapse
ecb04725  Cholinergic synapse
ecb04726  Serotonergic synapse
ecb04727  GABAergic synapse
ecb04728  Dopaminergic synapse
ecb04926  Relaxin signaling pathway
ecb05032  Morphine addiction
ecb05034  Alcoholism
ecb05163  Human cytomegalovirus infection
ecb05167  Kaposi sarcoma-associated herpesvirus infection
ecb05170  Human immunodeficiency virus 1 infection
ecb05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    100063795 (GNG3)
   04371 Apelin signaling pathway
    100063795 (GNG3)
   04151 PI3K-Akt signaling pathway
    100063795 (GNG3)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    100063795 (GNG3)
  09152 Endocrine system
   04926 Relaxin signaling pathway
    100063795 (GNG3)
  09156 Nervous system
   04724 Glutamatergic synapse
    100063795 (GNG3)
   04727 GABAergic synapse
    100063795 (GNG3)
   04725 Cholinergic synapse
    100063795 (GNG3)
   04728 Dopaminergic synapse
    100063795 (GNG3)
   04726 Serotonergic synapse
    100063795 (GNG3)
   04723 Retrograde endocannabinoid signaling
    100063795 (GNG3)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100063795 (GNG3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100063795 (GNG3)
  09165 Substance dependence
   05032 Morphine addiction
    100063795 (GNG3)
   05034 Alcoholism
    100063795 (GNG3)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100063795 (GNG3)
   05163 Human cytomegalovirus infection
    100063795 (GNG3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100063795 (GNG3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:ecb04031]
    100063795 (GNG3)
GTP-binding proteins [BR:ecb04031]
 Heterotrimeric G-proteins
  Gamma Subunits
   Gamma [OT]
    100063795 (GNG3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: G-gamma
Motif
Other DBs
NCBI-GeneID: 100063795
NCBI-ProteinID: XP_014585114
Ensembl: ENSECAG00000020169
VGNC: 18432
UniProt: F6T6I4
Position
12
AA seq 75 aa AA seqDB search
MKGETPVNSTMSIGQARKMVEQLKIEASLCRIKVSKAAADLMTYCDAHACEDPLITPVPT
SENPFREKKFFCALL
NT seq 228 nt NT seq  +upstreamnt  +downstreamnt
atgaaaggggagacccctgtgaacagcactatgagtattgggcaagcccgcaagatggtg
gaacagcttaagatcgaagccagcttgtgccggataaaggtgtccaaggcagcagcagac
ctgatgacttactgtgatgcccacgcctgtgaggatcccctcatcacccctgtgcccact
tcggagaaccccttccgggagaagaagttcttctgtgcccttctctga

KEGG   Equus caballus (horse): 100064813Help
Entry
100064813         CDS       T01058                                 

Gene name
GNG5
Definition
(RefSeq) guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-5
  KO
K04542  guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-5
Organism
ecb  Equus caballus (horse)
Pathway
ecb04014  Ras signaling pathway
ecb04062  Chemokine signaling pathway
ecb04151  PI3K-Akt signaling pathway
ecb04371  Apelin signaling pathway
ecb04713  Circadian entrainment
ecb04723  Retrograde endocannabinoid signaling
ecb04724  Glutamatergic synapse
ecb04725  Cholinergic synapse
ecb04726  Serotonergic synapse
ecb04727  GABAergic synapse
ecb04728  Dopaminergic synapse
ecb04926  Relaxin signaling pathway
ecb05032  Morphine addiction
ecb05034  Alcoholism
ecb05163  Human cytomegalovirus infection
ecb05167  Kaposi sarcoma-associated herpesvirus infection
ecb05170  Human immunodeficiency virus 1 infection
ecb05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    100064813 (GNG5)
   04371 Apelin signaling pathway
    100064813 (GNG5)
   04151 PI3K-Akt signaling pathway
    100064813 (GNG5)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    100064813 (GNG5)
  09152 Endocrine system
   04926 Relaxin signaling pathway
    100064813 (GNG5)
  09156 Nervous system
   04724 Glutamatergic synapse
    100064813 (GNG5)
   04727 GABAergic synapse
    100064813 (GNG5)
   04725 Cholinergic synapse
    100064813 (GNG5)
   04728 Dopaminergic synapse
    100064813 (GNG5)
   04726 Serotonergic synapse
    100064813 (GNG5)
   04723 Retrograde endocannabinoid signaling
    100064813 (GNG5)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100064813 (GNG5)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100064813 (GNG5)
  09165 Substance dependence
   05032 Morphine addiction
    100064813 (GNG5)
   05034 Alcoholism
    100064813 (GNG5)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100064813 (GNG5)
   05163 Human cytomegalovirus infection
    100064813 (GNG5)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100064813 (GNG5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ecb04147]
    100064813 (GNG5)
   04031 GTP-binding proteins [BR:ecb04031]
    100064813 (GNG5)
Exosome [BR:ecb04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100064813 (GNG5)
GTP-binding proteins [BR:ecb04031]
 Heterotrimeric G-proteins
  Gamma Subunits
   Gamma [OT]
    100064813 (GNG5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: G-gamma FtsX_ECD DUF3338 Suv3_N
Motif
Other DBs
NCBI-GeneID: 100064813
NCBI-ProteinID: XP_014595564
VGNC: 18434
Position
5
AA seq 68 aa AA seqDB search
MSGSSSVAAMKKVVQQLRLEAGLNRVKVSQAAADLKQFCLQNAQHDPLLTGVSSSTNPFR
PQKVCSFL
NT seq 207 nt NT seq  +upstreamnt  +downstreamnt
atgtctggttcctccagcgtcgccgctatgaagaaagtggttcagcagctccggctggag
gccgggctcaaccgcgtgaaggtttcccaggccgctgcagatttgaaacagttctgtctg
cagaacgctcaacatgaccccctgctgactggagtgtcttcaagtacgaatcccttcaga
ccccagaaagtctgttcctttttgtag

KEGG   Equus caballus (horse): 100065327Help
Entry
100065327         CDS       T01058                                 

Gene name
GNG13
Definition
(RefSeq) guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-13
  KO
K04547  guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-13
Organism
ecb  Equus caballus (horse)
Pathway
ecb04014  Ras signaling pathway
ecb04062  Chemokine signaling pathway
ecb04151  PI3K-Akt signaling pathway
ecb04371  Apelin signaling pathway
ecb04713  Circadian entrainment
ecb04723  Retrograde endocannabinoid signaling
ecb04724  Glutamatergic synapse
ecb04725  Cholinergic synapse
ecb04726  Serotonergic synapse
ecb04727  GABAergic synapse
ecb04728  Dopaminergic synapse
ecb04740  Olfactory transduction
ecb04742  Taste transduction
ecb04926  Relaxin signaling pathway
ecb05032  Morphine addiction
ecb05034  Alcoholism
ecb05163  Human cytomegalovirus infection
ecb05167  Kaposi sarcoma-associated herpesvirus infection
ecb05170  Human immunodeficiency virus 1 infection
ecb05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    100065327 (GNG13)
   04371 Apelin signaling pathway
    100065327 (GNG13)
   04151 PI3K-Akt signaling pathway
    100065327 (GNG13)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    100065327 (GNG13)
  09152 Endocrine system
   04926 Relaxin signaling pathway
    100065327 (GNG13)
  09156 Nervous system
   04724 Glutamatergic synapse
    100065327 (GNG13)
   04727 GABAergic synapse
    100065327 (GNG13)
   04725 Cholinergic synapse
    100065327 (GNG13)
   04728 Dopaminergic synapse
    100065327 (GNG13)
   04726 Serotonergic synapse
    100065327 (GNG13)
   04723 Retrograde endocannabinoid signaling
    100065327 (GNG13)
  09157 Sensory system
   04740 Olfactory transduction
    100065327 (GNG13)
   04742 Taste transduction
    100065327 (GNG13)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100065327 (GNG13)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100065327 (GNG13)
  09165 Substance dependence
   05032 Morphine addiction
    100065327 (GNG13)
   05034 Alcoholism
    100065327 (GNG13)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100065327 (GNG13)
   05163 Human cytomegalovirus infection
    100065327 (GNG13)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100065327 (GNG13)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:ecb04031]
    100065327 (GNG13)
GTP-binding proteins [BR:ecb04031]
 Heterotrimeric G-proteins
  Gamma Subunits
   Gamma [OT]
    100065327 (GNG13)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: G-gamma
Motif
Other DBs
NCBI-GeneID: 100065327
NCBI-ProteinID: XP_001496489
Ensembl: ENSECAG00000018282
VGNC: 18430
UniProt: F6Q3Q7
Position
13
AA seq 67 aa AA seqDB search
MEEWDVPQMKKEVESLKYQLAFKRELSSQTIPELLKWIEDGIPKDPFLNPELMKNNPWVE
RGKCAIL
NT seq 204 nt NT seq  +upstreamnt  +downstreamnt
atggaggagtgggatgtgccccagatgaagaaggaggtcgagagcctcaagtaccagctg
gccttcaagagggagctgtcctcccagaccatccccgagctccttaagtggatcgaggac
gggatccccaaggaccccttcctgaaccccgagctgatgaagaacaacccgtgggtggag
aggggcaagtgcgccatcctgtga

KEGG   Equus caballus (horse): 100067486Help
Entry
100067486         CDS       T01058                                 

Gene name
GNB2
Definition
(RefSeq) guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2
  KO
K04537  guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2
Organism
ecb  Equus caballus (horse)
Pathway
ecb04014  Ras signaling pathway
ecb04062  Chemokine signaling pathway
ecb04151  PI3K-Akt signaling pathway
ecb04371  Apelin signaling pathway
ecb04713  Circadian entrainment
ecb04723  Retrograde endocannabinoid signaling
ecb04724  Glutamatergic synapse
ecb04725  Cholinergic synapse
ecb04726  Serotonergic synapse
ecb04727  GABAergic synapse
ecb04728  Dopaminergic synapse
ecb04926  Relaxin signaling pathway
ecb05032  Morphine addiction
ecb05034  Alcoholism
ecb05163  Human cytomegalovirus infection
ecb05167  Kaposi sarcoma-associated herpesvirus infection
ecb05170  Human immunodeficiency virus 1 infection
ecb05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    100067486 (GNB2)
   04371 Apelin signaling pathway
    100067486 (GNB2)
   04151 PI3K-Akt signaling pathway
    100067486 (GNB2)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    100067486 (GNB2)
  09152 Endocrine system
   04926 Relaxin signaling pathway
    100067486 (GNB2)
  09156 Nervous system
   04724 Glutamatergic synapse
    100067486 (GNB2)
   04727 GABAergic synapse
    100067486 (GNB2)
   04725 Cholinergic synapse
    100067486 (GNB2)
   04728 Dopaminergic synapse
    100067486 (GNB2)
   04726 Serotonergic synapse
    100067486 (GNB2)
   04723 Retrograde endocannabinoid signaling
    100067486 (GNB2)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100067486 (GNB2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100067486 (GNB2)
  09165 Substance dependence
   05032 Morphine addiction
    100067486 (GNB2)
   05034 Alcoholism
    100067486 (GNB2)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100067486 (GNB2)
   05163 Human cytomegalovirus infection
    100067486 (GNB2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100067486 (GNB2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ecb04147]
    100067486 (GNB2)
   04031 GTP-binding proteins [BR:ecb04031]
    100067486 (GNB2)
Exosome [BR:ecb04147]
 Exosomal proteins
  Proteins found in most exosomes
   100067486 (GNB2)
GTP-binding proteins [BR:ecb04031]
 Heterotrimeric G-proteins
  Beta Subunits
   Beta [OT]
    100067486 (GNB2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: WD40 ANAPC4_WD40 WD40_like CALM_bind
Motif
Other DBs
NCBI-GeneID: 100067486
NCBI-ProteinID: XP_001505112
Ensembl: ENSECAG00000017221
VGNC: 18425
UniProt: F6WQ61
Position
13
AA seq 340 aa AA seqDB search
MSELEQLRQEAEQLRNQIRDARKACGDSTLTQITAGLDPVGRIQMRTRRTLRGHLAKIYA
MHWGTDSRLLVSASQDGKLIIWDSYTTNKVHAIPLRSSWVMTCAYAPSGNFVACGGLDNI
CSIYSLKTREGNVRVSRELPGHTGYLSCCRFLDDNQIITSSGDTTCALWDIETGQQTVGF
AGHSGDVMSLSLAPDGRTFVSGACDASIKLWDVRDSMCRQTFIGHESDINAVAFFPNGYA
FTTGSDDATCRLFDLRADQELLMYSHDNIICGITSVAFSRSGRLLLAGYDDFNCNIWDAM
KGDRAGVLAGHDNRVSCLGVTDDGMAVATGSWDSFLKIWN
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgagtgagctggagcaactgagacaggaggctgagcagctccggaaccagatccgggat
gcccgaaaagcatgtggggattcaacgctgacccagatcacagctgggctggacccagtg
gggaggatccagatgaggacacggaggaccctccgtgggcacctggcaaaaatctatgcc
atgcactgggggacagactcaaggctgctggtcagcgcctcccaggacgggaagctcatc
atctgggacagctacaccaccaacaaggtccatgccatcccactgcgctcctcctgggtc
atgacctgtgcctacgcgccctcagggaacttcgtggcctgtggggggttggacaacatc
tgctccatctacagcctcaagacccgtgagggcaatgtcagggtcagccgggagctgcct
ggccacactgggtacctgtcgtgctgccgcttcctggatgacaaccaaatcatcaccagc
tctggggacaccacctgtgctctgtgggacattgaaacaggccagcagacggtgggtttt
gctggacacagtggcgatgtgatgtccctgtcactggcccccgatggccgcacctttgtg
tcaggtgcctgcgacgcctccatcaagctgtgggacgtacgggattccatgtgccgacag
accttcattggccacgagtccgacatcaatgccgtggctttcttccccaatggctatgcc
ttcaccacgggttctgacgacgccacctgccgcctctttgacctgcgggccgaccaggag
ctccttatgtattcccacgacaacatcatctgtggcatcacctctgttgccttctcgcgc
agcggccggctgctgctcgctggctacgatgacttcaactgcaacatctgggatgccatg
aagggtgaccgtgctggtgtcctcgctggccacgacaaccgcgtgagctgcctcggggtc
actgacgatggcatggctgtggccacaggctcctgggactccttcctcaagatctggaac
taa

KEGG   Equus caballus (horse): 100069660Help
Entry
100069660         CDS       T01058                                 

Gene name
GNGT2
Definition
(RefSeq) guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-T2 isoform X2
  KO
K04549  guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-T2
Organism
ecb  Equus caballus (horse)
Pathway
ecb04014  Ras signaling pathway
ecb04062  Chemokine signaling pathway
ecb04151  PI3K-Akt signaling pathway
ecb04371  Apelin signaling pathway
ecb04713  Circadian entrainment
ecb04723  Retrograde endocannabinoid signaling
ecb04724  Glutamatergic synapse
ecb04725  Cholinergic synapse
ecb04726  Serotonergic synapse
ecb04727  GABAergic synapse
ecb04728  Dopaminergic synapse
ecb04926  Relaxin signaling pathway
ecb05032  Morphine addiction
ecb05034  Alcoholism
ecb05163  Human cytomegalovirus infection
ecb05167  Kaposi sarcoma-associated herpesvirus infection
ecb05170  Human immunodeficiency virus 1 infection
ecb05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    100069660 (GNGT2)
   04371 Apelin signaling pathway
    100069660 (GNGT2)
   04151 PI3K-Akt signaling pathway
    100069660 (GNGT2)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    100069660 (GNGT2)
  09152 Endocrine system
   04926 Relaxin signaling pathway
    100069660 (GNGT2)
  09156 Nervous system
   04724 Glutamatergic synapse
    100069660 (GNGT2)
   04727 GABAergic synapse
    100069660 (GNGT2)
   04725 Cholinergic synapse
    100069660 (GNGT2)
   04728 Dopaminergic synapse
    100069660 (GNGT2)
   04726 Serotonergic synapse
    100069660 (GNGT2)
   04723 Retrograde endocannabinoid signaling
    100069660 (GNGT2)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100069660 (GNGT2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100069660 (GNGT2)
  09165 Substance dependence
   05032 Morphine addiction
    100069660 (GNGT2)
   05034 Alcoholism
    100069660 (GNGT2)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100069660 (GNGT2)
   05163 Human cytomegalovirus infection
    100069660 (GNGT2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100069660 (GNGT2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:ecb04031]
    100069660 (GNGT2)
GTP-binding proteins [BR:ecb04031]
 Heterotrimeric G-proteins
  Gamma Subunits
   Gamma [OT]
    100069660 (GNGT2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: G-gamma DUF3294 Myc-LZ HAUS5
Motif
Other DBs
NCBI-GeneID: 100069660
NCBI-ProteinID: XP_001502366
Ensembl: ENSECAG00000016054
VGNC: 18438
Position
11
AA seq 69 aa AA seqDB search
MAQDLSEKELLKMEVEQLKKEVKNTRLPISKTGKEIKEYVEAEAGNDPLLKGVPEDKNPF
KEKGSCVIS
NT seq 210 nt NT seq  +upstreamnt  +downstreamnt
atggcccaggacctcagtgagaaggagctgttgaagatggaggtggagcagctgaagaag
gaagtgaagaacactagacttccgatttccaagacaggaaaggaaatcaaggaatatgtg
gaggctgaagcaggaaatgacccacttctcaaaggcgtccctgaggacaagaatcccttc
aaggagaagggctcttgtgtgatcagctga

KEGG   Equus caballus (horse): 100146498Help
Entry
100146498         CDS       T01058                                 

Gene name
GNB5
Definition
(RefSeq) guanine nucleotide-binding protein subunit beta-5
  KO
K04539  guanine nucleotide-binding protein subunit beta-5
Organism
ecb  Equus caballus (horse)
Pathway
ecb04014  Ras signaling pathway
ecb04062  Chemokine signaling pathway
ecb04151  PI3K-Akt signaling pathway
ecb04371  Apelin signaling pathway
ecb04713  Circadian entrainment
ecb04723  Retrograde endocannabinoid signaling
ecb04724  Glutamatergic synapse
ecb04725  Cholinergic synapse
ecb04726  Serotonergic synapse
ecb04727  GABAergic synapse
ecb04728  Dopaminergic synapse
ecb04926  Relaxin signaling pathway
ecb05032  Morphine addiction
ecb05034  Alcoholism
ecb05163  Human cytomegalovirus infection
ecb05167  Kaposi sarcoma-associated herpesvirus infection
ecb05170  Human immunodeficiency virus 1 infection
ecb05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    100146498 (GNB5)
   04371 Apelin signaling pathway
    100146498 (GNB5)
   04151 PI3K-Akt signaling pathway
    100146498 (GNB5)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    100146498 (GNB5)
  09152 Endocrine system
   04926 Relaxin signaling pathway
    100146498 (GNB5)
  09156 Nervous system
   04724 Glutamatergic synapse
    100146498 (GNB5)
   04727 GABAergic synapse
    100146498 (GNB5)
   04725 Cholinergic synapse
    100146498 (GNB5)
   04728 Dopaminergic synapse
    100146498 (GNB5)
   04726 Serotonergic synapse
    100146498 (GNB5)
   04723 Retrograde endocannabinoid signaling
    100146498 (GNB5)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100146498 (GNB5)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100146498 (GNB5)
  09165 Substance dependence
   05032 Morphine addiction
    100146498 (GNB5)
   05034 Alcoholism
    100146498 (GNB5)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100146498 (GNB5)
   05163 Human cytomegalovirus infection
    100146498 (GNB5)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100146498 (GNB5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ecb04147]
    100146498 (GNB5)
   04031 GTP-binding proteins [BR:ecb04031]
    100146498 (GNB5)
Exosome [BR:ecb04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100146498 (GNB5)
GTP-binding proteins [BR:ecb04031]
 Heterotrimeric G-proteins
  Beta Subunits
   Beta [OT]
    100146498 (GNB5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: WD40 ANAPC4_WD40 WD40_like
Motif
Other DBs
NCBI-GeneID: 100146498
NCBI-ProteinID: XP_023473074
VGNC: 51526
Position
1
AA seq 353 aa AA seqDB search
MATDGLHENETLASLKSEAESLKGKLEEERAKLHDVELHQVAERVEALGQFVMKTRRTLK
GHGNKVLCMDWCKDKRRIVSSSQDGKVIVWDSFTTNKEHAVTMPCTWVMACAYAPSGCAI
ACGGLDNKCSVYPLTFDKNENMAAKKKSVAMHTNYLSACSFTNSDMQILTASGDGTCALW
DVESGQLLQSFHGHGADVLCLDLAPSETGNTFVSGGCDKKAMVWDMRSGQCVQAFETHES
DINSVRYYPSGDAFASGSDDATCRLYDLRADREVAIYSKESIIFGASSVDFSLSGRLLFA
GYNDYTINVWDVLKGSRVSILFGHENRVSTLRVSPDGTAFCSGSWDHTLRVWA
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atggccaccgacgggctgcacgagaacgagacgctggcgtcgctgaagagcgaggccgag
agcctcaagggcaaactggaggaggagcgggccaagctgcacgacgtggagctgcaccag
gtggcggagcgggtggaggccctggggcagtttgtcatgaagaccagaaggaccctcaaa
ggccatgggaataaagttctctgcatggactggtgcaaagacaagaggaggatcgtgagc
tcatcgcaggacgggaaggtgatcgtgtgggattccttcactaccaacaaggagcacgcg
gtcactatgccctgcacgtgggtgatggcgtgtgcgtacgccccatcaggatgtgccatt
gcgtgtggtggtttggataataagtgttctgtgtatccactgacgtttgacaaaaatgaa
aacatggctgccaaaaagaagtctgttgctatgcataccaactacctttcggcctgcagc
ttcaccaactctgacatgcagatcctgacggcgagcggcgatgggacgtgtgccctgtgg
gacgtggagagcgggcagctgcttcagagcttccacggacatggggccgacgtgctctgc
ttggacctggccccctcggaaacgggaaacaccttcgtgtctgggggatgtgacaagaaa
gccatggtgtgggacatgcgctctggccagtgcgtgcaggcctttgaaacacacgagtct
gacatcaacagtgtccgatactacccgagtggagatgcctttgcctcaggatcagatgat
gctacgtgtcgcctctacgacctccgcgcagacagggaggtcgccatctattccaaagag
agtatcatatttggagcctccagcgtggacttctccctcagtgggcgcctgctatttgct
ggatacaacgattataccatcaacgtctgggatgttctcaagggatcccgagtctccatc
ctgtttggtcatgaaaaccgcgttagtactctccgagtttcccctgatgggactgcgttt
tgctcaggatcgtgggatcataccctaagagtctgggcttga

KEGG   Equus caballus (horse): 100630067Help
Entry
100630067         CDS       T01058                                 

Gene name
GNG2
Definition
(RefSeq) guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-2
  KO
K07826  guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-2
Organism
ecb  Equus caballus (horse)
Pathway
ecb04014  Ras signaling pathway
ecb04062  Chemokine signaling pathway
ecb04151  PI3K-Akt signaling pathway
ecb04371  Apelin signaling pathway
ecb04713  Circadian entrainment
ecb04723  Retrograde endocannabinoid signaling
ecb04724  Glutamatergic synapse
ecb04725  Cholinergic synapse
ecb04726  Serotonergic synapse
ecb04727  GABAergic synapse
ecb04728  Dopaminergic synapse
ecb04926  Relaxin signaling pathway
ecb05032  Morphine addiction
ecb05034  Alcoholism
ecb05163  Human cytomegalovirus infection
ecb05167  Kaposi sarcoma-associated herpesvirus infection
ecb05170  Human immunodeficiency virus 1 infection
ecb05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    100630067 (GNG2)
   04371 Apelin signaling pathway
    100630067 (GNG2)
   04151 PI3K-Akt signaling pathway
    100630067 (GNG2)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    100630067 (GNG2)
  09152 Endocrine system
   04926 Relaxin signaling pathway
    100630067 (GNG2)
  09156 Nervous system
   04724 Glutamatergic synapse
    100630067 (GNG2)
   04727 GABAergic synapse
    100630067 (GNG2)
   04725 Cholinergic synapse
    100630067 (GNG2)
   04728 Dopaminergic synapse
    100630067 (GNG2)
   04726 Serotonergic synapse
    100630067 (GNG2)
   04723 Retrograde endocannabinoid signaling
    100630067 (GNG2)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100630067 (GNG2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100630067 (GNG2)
  09165 Substance dependence
   05032 Morphine addiction
    100630067 (GNG2)
   05034 Alcoholism
    100630067 (GNG2)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100630067 (GNG2)
   05163 Human cytomegalovirus infection
    100630067 (GNG2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100630067 (GNG2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ecb04147]
    100630067 (GNG2)
   04031 GTP-binding proteins [BR:ecb04031]
    100630067 (GNG2)
Exosome [BR:ecb04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100630067 (GNG2)
GTP-binding proteins [BR:ecb04031]
 Heterotrimeric G-proteins
  Gamma Subunits
   Gamma [OT]
    100630067 (GNG2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: G-gamma FtsX_ECD CP12 CHASE8
Motif
Other DBs
NCBI-GeneID: 100630067
NCBI-ProteinID: XP_005603524
Ensembl: ENSECAG00000012584
VGNC: 18431
Position
1
AA seq 71 aa AA seqDB search
MASNNTASIAQARKLVEQLKMEANIDRIKVSKAAADLMAYCEAHAKEDPLLTPVPASENP
FREKKFFCAIL
NT seq 216 nt NT seq  +upstreamnt  +downstreamnt
atggccagcaacaacactgccagcatagcacaagccaggaagctggtggaacagctgaag
atggaagccaacatcgacaggataaaggtgtccaaggcagctgcagacctgatggcctac
tgtgaggcacatgccaaggaagatcccctcctgacccccgttccggcttcagagaacccg
tttagggagaagaagtttttctgcgctatcctttaa

KEGG   Equus caballus (horse): 100630493Help
Entry
100630493         CDS       T01058                                 

Gene name
GNG10
Definition
(RefSeq) guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-10
  KO
K04545  guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-10
Organism
ecb  Equus caballus (horse)
Pathway
ecb04014  Ras signaling pathway
ecb04062  Chemokine signaling pathway
ecb04151  PI3K-Akt signaling pathway
ecb04371  Apelin signaling pathway
ecb04713  Circadian entrainment
ecb04723  Retrograde endocannabinoid signaling
ecb04724  Glutamatergic synapse
ecb04725  Cholinergic synapse
ecb04726  Serotonergic synapse
ecb04727  GABAergic synapse
ecb04728  Dopaminergic synapse
ecb04926  Relaxin signaling pathway
ecb05032  Morphine addiction
ecb05034  Alcoholism
ecb05163  Human cytomegalovirus infection
ecb05167  Kaposi sarcoma-associated herpesvirus infection
ecb05170  Human immunodeficiency virus 1 infection
ecb05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    100630493 (GNG10)
   04371 Apelin signaling pathway
    100630493 (GNG10)
   04151 PI3K-Akt signaling pathway
    100630493 (GNG10)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    100630493 (GNG10)
  09152 Endocrine system
   04926 Relaxin signaling pathway
    100630493 (GNG10)
  09156 Nervous system
   04724 Glutamatergic synapse
    100630493 (GNG10)
   04727 GABAergic synapse
    100630493 (GNG10)
   04725 Cholinergic synapse
    100630493 (GNG10)
   04728 Dopaminergic synapse
    100630493 (GNG10)
   04726 Serotonergic synapse
    100630493 (GNG10)
   04723 Retrograde endocannabinoid signaling
    100630493 (GNG10)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100630493 (GNG10)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100630493 (GNG10)
  09165 Substance dependence
   05032 Morphine addiction
    100630493 (GNG10)
   05034 Alcoholism
    100630493 (GNG10)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100630493 (GNG10)
   05163 Human cytomegalovirus infection
    100630493 (GNG10)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100630493 (GNG10)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:ecb04031]
    100630493 (GNG10)
GTP-binding proteins [BR:ecb04031]
 Heterotrimeric G-proteins
  Gamma Subunits
   Gamma [OT]
    100630493 (GNG10)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: G-gamma FtsX_ECD
Motif
Other DBs
NCBI-GeneID: 100630493
NCBI-ProteinID: XP_023484419
Position
25
AA seq 68 aa AA seqDB search
MASGASVLALQRLVEQLKLEAGVERIKVSQAAAELQRYCMQNACKDALLVGVPAGSNPFR
EPRSCALL
NT seq 207 nt NT seq  +upstreamnt  +downstreamnt
atggcttccggggccagcgtgctcgccctgcagcgcctggtggagcagctcaagctggag
gccggcgtggagcgcatcaaggtttctcaggcagctgcagagcttcagcggtactgcatg
cagaatgcctgcaaggatgccctgctggttggtgtaccagccggaagcaaccccttccgg
gagcccagatcctgcgctttactctga

KEGG   Equus caballus (horse): 100630574Help
Entry
100630574         CDS       T01058                                 

Gene name
GNG12
Definition
(RefSeq) guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-12
  KO
K04347  guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-12
Organism
ecb  Equus caballus (horse)
Pathway
ecb04010  MAPK signaling pathway
ecb04014  Ras signaling pathway
ecb04062  Chemokine signaling pathway
ecb04151  PI3K-Akt signaling pathway
ecb04371  Apelin signaling pathway
ecb04713  Circadian entrainment
ecb04723  Retrograde endocannabinoid signaling
ecb04724  Glutamatergic synapse
ecb04725  Cholinergic synapse
ecb04726  Serotonergic synapse
ecb04727  GABAergic synapse
ecb04728  Dopaminergic synapse
ecb04810  Regulation of actin cytoskeleton
ecb04926  Relaxin signaling pathway
ecb05032  Morphine addiction
ecb05034  Alcoholism
ecb05163  Human cytomegalovirus infection
ecb05167  Kaposi sarcoma-associated herpesvirus infection
ecb05170  Human immunodeficiency virus 1 infection
ecb05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    100630574 (GNG12)
   04010 MAPK signaling pathway
    100630574 (GNG12)
   04371 Apelin signaling pathway
    100630574 (GNG12)
   04151 PI3K-Akt signaling pathway
    100630574 (GNG12)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100630574 (GNG12)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    100630574 (GNG12)
  09152 Endocrine system
   04926 Relaxin signaling pathway
    100630574 (GNG12)
  09156 Nervous system
   04724 Glutamatergic synapse
    100630574 (GNG12)
   04727 GABAergic synapse
    100630574 (GNG12)
   04725 Cholinergic synapse
    100630574 (GNG12)
   04728 Dopaminergic synapse
    100630574 (GNG12)
   04726 Serotonergic synapse
    100630574 (GNG12)
   04723 Retrograde endocannabinoid signaling
    100630574 (GNG12)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100630574 (GNG12)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100630574 (GNG12)
  09165 Substance dependence
   05032 Morphine addiction
    100630574 (GNG12)
   05034 Alcoholism
    100630574 (GNG12)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100630574 (GNG12)
   05163 Human cytomegalovirus infection
    100630574 (GNG12)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100630574 (GNG12)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ecb04147]
    100630574 (GNG12)
   04031 GTP-binding proteins [BR:ecb04031]
    100630574 (GNG12)
Exosome [BR:ecb04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100630574 (GNG12)
  Exosomal proteins of colorectal cancer cells
   100630574 (GNG12)
GTP-binding proteins [BR:ecb04031]
 Heterotrimeric G-proteins
  Gamma Subunits
   Gamma [OT]
    100630574 (GNG12)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: G-gamma CP12
Motif
Other DBs
NCBI-GeneID: 100630574
NCBI-ProteinID: XP_003365157
Ensembl: ENSECAG00000014104
VGNC: 18429
UniProt: A0A3Q2I997
Position
5
AA seq 72 aa AA seqDB search
MSSKTASTNNIAQARRTVQQLRLEASIERIKVSKASADLMSYCEEHARSDPLLIGIPTSE
NPFKDKKTCVIL
NT seq 219 nt NT seq  +upstreamnt  +downstreamnt
atgtcgagcaaaacagcaagcaccaacaacatcgcccaggcaaggaggaccgtgcagcag
ctgaggctagaggcctccattgagagaataaaggtttcgaaggcgtccgcggacctcatg
tcctactgtgaggagcacgccaggagtgacccgttactgatagggatccccacttcagaa
aaccccttcaaggataaaaagacttgcgtcatcttatag

KEGG   Equus caballus (horse): 106782014Help
Entry
106782014         CDS       T01058                                 

Gene name
GNG8
Definition
(RefSeq) guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-8
  KO
K04544  guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-8
Organism
ecb  Equus caballus (horse)
Pathway
ecb04014  Ras signaling pathway
ecb04062  Chemokine signaling pathway
ecb04151  PI3K-Akt signaling pathway
ecb04371  Apelin signaling pathway
ecb04713  Circadian entrainment
ecb04723  Retrograde endocannabinoid signaling
ecb04724  Glutamatergic synapse
ecb04725  Cholinergic synapse
ecb04726  Serotonergic synapse
ecb04727  GABAergic synapse
ecb04728  Dopaminergic synapse
ecb04926  Relaxin signaling pathway
ecb05032  Morphine addiction
ecb05034  Alcoholism
ecb05163  Human cytomegalovirus infection
ecb05167  Kaposi sarcoma-associated herpesvirus infection
ecb05170  Human immunodeficiency virus 1 infection
ecb05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    106782014 (GNG8)
   04371 Apelin signaling pathway
    106782014 (GNG8)
   04151 PI3K-Akt signaling pathway
    106782014 (GNG8)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    106782014 (GNG8)
  09152 Endocrine system
   04926 Relaxin signaling pathway
    106782014 (GNG8)
  09156 Nervous system
   04724 Glutamatergic synapse
    106782014 (GNG8)
   04727 GABAergic synapse
    106782014 (GNG8)
   04725 Cholinergic synapse
    106782014 (GNG8)
   04728 Dopaminergic synapse
    106782014 (GNG8)
   04726 Serotonergic synapse
    106782014 (GNG8)
   04723 Retrograde endocannabinoid signaling
    106782014 (GNG8)
  09159 Environmental adaptation
   04713 Circadian entrainment
    106782014 (GNG8)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    106782014 (GNG8)
  09165 Substance dependence
   05032 Morphine addiction
    106782014 (GNG8)
   05034 Alcoholism
    106782014 (GNG8)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    106782014 (GNG8)
   05163 Human cytomegalovirus infection
    106782014 (GNG8)
   05167 Kaposi sarcoma-associated herpesvirus infection
    106782014 (GNG8)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:ecb04031]
    106782014 (GNG8)
GTP-binding proteins [BR:ecb04031]
 Heterotrimeric G-proteins
  Gamma Subunits
   Gamma [OT]
    106782014 (GNG8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: G-gamma Flexi_CP
Motif
Other DBs
NCBI-GeneID: 106782014
NCBI-ProteinID: XP_014588350
Ensembl: ENSECAG00000024662
VGNC: 18436
UniProt: F6R7Y1
Position
10
AA seq 70 aa AA seqDB search
MSNNMAKIAEARKTVEQLKLEVNIDRMKVSQAAAELLSFCETHAKDDPLVTPVPAAENPF
RDKRLFCVLL
NT seq 213 nt NT seq  +upstreamnt  +downstreamnt
atgtccaacaacatggccaagatcgcggaggcccgcaagacggtggaacagctgaagctg
gaggtgaacatcgaccgcatgaaggtgtcgcaggcggcggccgagctcctatcgttctgc
gagacgcacgctaaagacgacccgctggtgacgccggtgccggccgcagagaaccccttc
cgcgacaagcgcctcttctgcgtcctgctctga

DBGET integrated database retrieval system