KEGG   Equus caballus (horse): 100051379
Entry
100051379         CDS       T01058                                 

Gene name
RDH5
Definition
(RefSeq) 11-cis retinol dehydrogenase
  KO
K00061  11-cis-retinol dehydrogenase [EC:1.1.1.315]
Organism
ecb  Equus caballus (horse)
Pathway
ecb00830  Retinol metabolism
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    100051379 (RDH5)
Enzymes [BR:ecb01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.315  11-cis-retinol dehydrogenase
     100051379 (RDH5)
SSDB
Motif
Pfam: adh_short adh_short_C2 KR DUF1776
Other DBs
NCBI-GeneID: 100051379
NCBI-ProteinID: XP_001504826
Ensembl: ENSECAG00000019692
VGNC: 22281
UniProt: F7CLW5
Position
6
AA seq 318 aa
MWLPLLLGTLLWVALWLLRDQQSLPASDAFVFITGCDSGFGRLLALRLDQRGFRVLASCL
TPSGAEDLQRVASSRLHTTLLDVTDPQSVQRAAKWVETHVGEAGLFGLVNNAGVAGIIGP
TPWLTRDDFHRVLNVNTLGPIGVTLALLPLLQQARGRVINVTSVLGRLAANGGGYCVSKF
GLEAFSDSLRRDVAPFGVRVSIVEPGFFQTPVTNLKSLENALQACWARLPPATQAHYGEA
FLTKYLKVQQRIMNLLCDPDLTKVSKCLEHALTARHPRTRYSPGWDAKLLWLPASYLPAS
LVDAMLTWVLPKPAHAIY
NT seq 957 nt   +upstreamnt  +downstreamnt
atgtggctgcctctgctgctgggaaccttgctctgggtggcgctgtggctgctcagggac
cagcagagcctgcccgccagcgatgccttcgtcttcatcacgggttgtgactcaggcttc
gggcggcttctggcactgagactggaccagagaggcttccgagtcctggccagctgcctg
accccctcaggggcagaggacctccagcgggtggcctcctcccgcctccacaccactctg
ctggatgtcactgatccccagagtgtccagcgggcagccaagtgggtggagacacatgtt
ggggaagcagggctttttggtctggtgaataatgctggtgtggctggtatcatcggaccc
acaccgtggctgacacgggatgatttccaccgggtgctgaatgtgaacacactgggtccc
atcggggtcacacttgccctgctgcccctgctgcagcaggcccggggccgggtgatcaat
gtcactagtgtcctgggtcgcctagcagccaatggtgggggctactgtgtctccaagttt
ggcctggaggctttctcggacagcctgaggcgggacgtggctccttttggggtccgagtc
tccatcgtggagcctggtttcttccaaacccctgtgacaaacctgaagagtctggagaac
gccctgcaggcctgctgggcacggctccctccagccacacaggcccactatggggaggcc
ttcctcaccaagtacctgaaggtgcagcagcgcatcatgaacctgctctgtgacccggac
ctgaccaaggtgagcaagtgcctggagcatgccctgactgctcgtcaccccaggacccgc
tacagcccaggctgggacgccaagctgctctggctgccagcttcctacctgccagccagc
ctggtggatgccatgctcacctgggtccttcccaagcctgcccatgccatctactga

DBGET integrated database retrieval system