KEGG   Equus caballus (horse): 100051450
Entry
100051450         CDS       T01058                                 
Symbol
CD63
Name
(RefSeq) CD63 antigen
  KO
K06497  CD63 antigen
Organism
ecb  Equus caballus (horse)
Pathway
ecb04142  Lysosome
ecb05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    100051450 (CD63)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    100051450 (CD63)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ecb04147]
    100051450 (CD63)
   04090 CD molecules [BR:ecb04090]
    100051450 (CD63)
Exosome [BR:ecb04147]
 Exosomal proteins
  Proteins found in most exosomes
   100051450 (CD63)
CD molecules [BR:ecb04090]
 Proteins
  100051450 (CD63)
SSDB
Motif
Pfam: Tetraspanin
Other DBs
NCBI-GeneID: 100051450
NCBI-ProteinID: XP_023499518
Ensembl: ENSECAG00000020385
VGNC: 16275
Position
6:complement(74416971..74420205)
AA seq 238 aa
MAVEGGMKCVKFMLYVLLLAFCACAVGLIAVGVATQVVLSQTIIPGATTGSLVPVVIIAV
GAFLFLVAFVGCCGACKENYCLMITFAVFLSLITLVEVAAAIAGYVFRDRVMSEFSKDFK
QQMQNYPKDNHTALILDRMQEKFHCCGATNYTDWETIPLPVKGQVPDSCCVNVTQGCGTK
FTEKDIYTKGCVEKIGGWLRKNVLVVAAAALGIAFVEVLGIVFACCLVKSIRSGYEVM
NT seq 717 nt   +upstreamnt  +downstreamnt
atggcggtggaaggaggaatgaaatgtgtcaagttcatgctctacgttcttctgctggcc
ttttgcgcctgcgcagtgggtctgattgctgtgggtgtagcaacccaggtggtcctgagt
cagaccatcatcccgggagccaccactggctccctcgtgcccgtggtcatcatcgcagtg
ggtgccttcctcttcctggtggcctttgtgggctgctgtggggcctgcaaggagaactac
tgtcttatgatcacgtttgccgtcttcctgtctcttatcacgctggtggaggtggccgca
gccatagctggctatgtctttagagacagggtaatgtcagaatttagtaaggacttcaag
cagcagatgcaaaattatccaaaagacaaccacactgctttgatcctggacaggatgcag
gaaaaattccactgctgcggcgcaactaactatactgactgggagaccatccctctcccg
gtcaagggccaagtccctgactcctgctgcgtcaatgtcactcagggctgcgggactaag
ttcaccgagaaggacatctataccaagggctgtgtggagaagattgggggctggctgagg
aaaaatgtgctggtggtggctgcagcagccctgggcattgcctttgtggaggtcctggga
attgtctttgcctgctgccttgtgaagagtatccgaagtggctatgaggtgatgtag

DBGET integrated database retrieval system