KEGG   Equus caballus (horse): 100051453
Entry
100051453         CDS       T01058                                 

Gene name
TULP2
Definition
(RefSeq) tubby-related protein 2 isoform X1
  KO
K19600  tubby and related proteins
Organism
ecb  Equus caballus (horse)
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:ecb04990]
    100051453 (TULP2)
Domain-containing proteins not elsewhere classified [BR:ecb04990]
 Other domain-containing proteins
  Tubby family proteins
   100051453 (TULP2)
SSDB
Motif
Pfam: Tub Tub_N DUF3527
Other DBs
NCBI-GeneID: 100051453
NCBI-ProteinID: XP_001489649
Ensembl: ENSECAG00000010999
VGNC: 24667
Position
10
AA seq 510 aa
MSQENDTWKKEVLEDELAAMRLQKLEQQRRLFEKKQRRKRQEPLMVQANSDTSLRQGRLR
WREERLWGDSGLGNPFLQRNVPRTHPRSGAHSDLSTVSCSGDGSGERGPLVPPTEAESSD
LELEEVSVEDVPAFPPPYKEPPGTRRRGWPALQRSGASAEEESESRDVGDEYETLRAEPN
PRMDGYGGRGDLASSKGEDVEEKEEESESTARNSPGVADEEMSEAPESKGDAGSSNVGSS
PHSPPRAPGPRLGEDMEAYVLRPALRGHTVQCRISRDKRGVDKGMFPIYYLYLEAADGWK
HFLLAGRKRKRSKTSNYLISLDPTDLSRDGDNFVGKVRSNVFGTKFTIFNNGVNPEKKNV
IPETARIREELGAVCYETNVLGFRGPRKMTVIIPGIDAQNQRISIQPQNEQESLLSRLQR
GASRGLVLLQNKAPSWSDESGAYVLDFHGRVTRASVKNFQIVHPDDPDYLVLQFGRVAPD
TFTMDFRFPLCPLQAFAICLSSFDGKLACE
NT seq 1533 nt   +upstreamnt  +downstreamnt
atgtctcaggagaatgacacttggaaaaaagaggtcctggaggatgagcttgctgccatg
aggctgcagaagctggaacagcagcggcggctgtttgagaagaagcagcgacggaagcgc
caagagcccctcatggttcaggccaattctgacacttccctgcggcaggggcgactgcgg
tggcgagaggaacgcctctggggtgacagcggcctcgggaaccctttcctccagaggaac
gtgcccaggacacatccgcgctctggtgcccacagtgacctgagcaccgtgagctgcagt
ggagatggcagcggtgagcgcggtcccctggtgccgccgacagaagcagaaagttccgat
ctggagttggaggaagtctccgtggaggatgttcctgcctttccccctccttataaagag
cctccggggactcgacgcaggggttggccagccctccaacgatctggggcgagtgcagaa
gaggagagcgaatctcgggatgttggagatgaatacgagacgctcagagcggaaccaaat
cctagaatggatggttacgggggacgtggtgacttggcttccagcaagggcgaagacgtg
gaagagaaggaagaggagtcggagtctacagcgaggaactctccaggggtggccgacgag
gaaatgtccgaggccccggaaagcaagggcgacgctggcagcagcaatgtggggagttcg
ccccactcgcctccccgcgccccaggccctcggttgggcgaggacatggaagcgtatgtg
ctgcggccagcgctgcgcggccacacggtgcagtgtcgcatcagccgcgacaagcgtggt
gtagacaagggcatgttccctatctactacctctacctggaggcggctgacggctggaag
cacttccttctggctgggcgcaagaggaaaaggagcaaaacctctaattatctcatctcc
ctggaccccacagacctgtctcgggatggggacaactttgtgggcaaagtcagatccaat
gtctttggcaccaagttcactatcttcaacaatggggtgaatcccgaaaagaagaatgtc
atcccggaaactgctcggatcagggaggagctgggggctgtgtgctatgagacaaacgtc
ttgggattccgagggccccggaaaatgactgtgatcattccaggaatcgacgcccagaac
cagagaattagcatccagccacaaaatgaacaggagtcgctactgagtcgcctccagcgg
ggcgccagccgggggctggtcctgctgcaaaacaaagccccatcgtggagcgacgagagc
ggcgcctacgtgctcgattttcatggtcgagtcactcgggcctcggtcaagaacttccag
atcgtgcatccggatgacccggattacctggtgctccagttcggccgcgtggcgccggac
acgttcaccatggacttccgcttcccgctttgcccgctgcaagccttcgccatctgctta
tccagtttcgacgggaagctggcgtgtgagtaa

DBGET integrated database retrieval system