KEGG   Equus caballus (horse): 100051483Help
Entry
100051483         CDS       T01058                                 

Definition
(RefSeq) lysosomal thioesterase PPT2 isoform X6
  KO
K01074  palmitoyl-protein thioesterase [EC:3.1.2.22]
Organism
ecb  Equus caballus (horse)
Pathway
ecb00062  Fatty acid elongation
ecb01100  Metabolic pathways
ecb01212  Fatty acid metabolism
ecb04142  Lysosome
Brite
KEGG Orthology (KO) [BR:ecb00001]
 Metabolism
  Lipid metabolism
   00062 Fatty acid elongation
    100051483
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    100051483
Enzymes [BR:ecb01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.22  palmitoyl[protein] hydrolase
     100051483
Lipid biosynthesis proteins [BR:ecb01004]
 Fatty acid synthase
  Component type
   100051483
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Palm_thioest Abhydrolase_1 DUF676 Abhydrolase_6 PGAP1 Hydrolase_4
Motif
Other DBs
NCBI-GeneID: 100051483
NCBI-ProteinID: XP_001493366
Ensembl: ENSECAG00000009021 ENSECAG00000017868
VGNC: 17458
UniProt: F6RR71
Position
20
AA seq 308 aa AA seqDB search
MKSCGSMLGLRGPQLPPAGILLLLPFLLLLPPAAPAPHRASYKPVIVVHGLFDSSYSFRH
LLEYINETHPGTVVTVLDLFDGRESLRPLWEQVQGFGEAVAPIMAQAPQGVHLICYSQGG
LVCRALLSVMDEHNVDSFISLSSPQMGQYGDTDYLKWLFPTSMRSNLYRICYSPWGQGFS
ICNYWHDPHHDDLYLNASSFLALINGERDHPNATAWRKNFLRVGRLVLIGGPDDGVITPW
QSSFFGFYDANETVLEMEEQLVYLRDSFGLKTLLARGAIVRCPMAGISHTAWHSNRTLYE
TCIEPWLS
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atgaagagttgcgggagcatgctggggctccgggggccgcagctacccccggcagggatc
ctgctcctgttgccattcctgctgctgctgccgcccgcagcccccgcgccccatcgggct
tcctacaagccggtcatcgtggtgcacgggctttttgacagctcgtatagcttccgccac
ctgctggaatacatcaatgagacacaccccgggactgtggtgacagtgctcgatctcttc
gatgggagagagagcttgcggcccctgtgggaacaggtgcaagggttcggagaggctgtg
gcccccatcatggcacaggcccctcaaggggtgcatctcatctgctattcgcaggggggc
ctggtgtgccgagcactgctctctgtgatggatgagcacaatgtggattctttcatctct
ctctcctctccacagatgggacagtatggagacacggactatttgaagtggctgttccct
acctccatgaggtctaacctctaccggatctgctatagcccatggggccagggattctcc
atctgcaactactggcatgacccccaccacgatgacttgtacctcaatgccagcagcttc
ctggccctgatcaacggggaaagagaccatcccaatgccactgcatggaggaagaacttt
cttcgtgtgggccgcctggtgctgattggaggccctgatgatggtgttattaccccctgg
cagtccagcttctttggtttctatgatgcaaatgagacggtcttggagatggaggaacaa
ctggtttatctgcgagattcctttgggttgaagactctcttggcccgtggggccatagtg
aggtgtccgatggctgggatctcccacacagcctggcactccaaccgcactctttatgag
acctgcattgaaccttggctctcctga

DBGET integrated database retrieval system