KEGG   Equus caballus (horse): 100051543Help
Entry
100051543         CDS       T01058                                 

Gene name
UGP2
Definition
(RefSeq) UTP--glucose-1-phosphate uridylyltransferase isoform X3
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
ecb  Equus caballus (horse)
Pathway
ecb00040  Pentose and glucuronate interconversions
ecb00052  Galactose metabolism
ecb00500  Starch and sucrose metabolism
ecb00520  Amino sugar and nucleotide sugar metabolism
ecb01100  Metabolic pathways
Module
ecb_M00129  Ascorbate biosynthesis, animals, glucose-1P => ascorbate
ecb_M00361  Nucleotide sugar biosynthesis, eukaryotes
ecb_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ecb00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    100051543 (UGP2)
   00052 Galactose metabolism
    100051543 (UGP2)
   00500 Starch and sucrose metabolism
    100051543 (UGP2)
   00520 Amino sugar and nucleotide sugar metabolism
    100051543 (UGP2)
Enzymes [BR:ecb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     100051543 (UGP2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UDPGP
Motif
Other DBs
NCBI-GeneID: 100051543
NCBI-ProteinID: XP_001494216
Ensembl: ENSECAG00000016705
VGNC: 24778
Position
15
AA seq 497 aa AA seqDB search
MSQDGASQFQEVIRQELEFSVKKELEKILTTAPSHEFEHTKKDLDGFRKLFHRFLQEKGP
SVDWGKIQRPPEDSIQPYEKIKARGLPDNISSVLNKLVVVKLNGGLGTSMGCKGPKSLIG
VRNENTFLDLTVQQIEHLNKSYNTDVPLVLMNSFNTDEDTKKILQKYNHCRVKIYTFNQS
RYPRINKESLLPVAKDVSYSGENTEAWYPPGHGDIYASFYNSGLLDTFIGEGKEYIFVSN
IDNLGATVDLYILNHLMNPPNGKPCEFVMEVTNKTRADVKGGTLTQYEGKLRLVEIAQVP
KAHVDEFKSVSKFKIFNTNNLWISLAAVKRLQEQNAIDMEIIVNPKTLDGGLNVIQLETA
VGAAIKSFENSLGINVPRSRFLPVKTTSDLLLVMSNLYSLNAGSLTMSEKREFPTVPLVK
LGSSFTKVQDYLRRFESIPDMLELDHLTVSGDVTFGKNVSLKGTVIIIANHGDRIDIPPG
AVLENKIVSGNLRILDH
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atgtctcaagatggtgcttctcagttccaagaagtcattcgacaagagctagaattttct
gtgaagaaggaactagaaaaaatacttaccacagcaccatcacatgagtttgagcacact
aaaaaagaccttgatggatttcggaaactatttcatagatttttgcaagaaaagggacct
tcagtggattgggggaaaatccagagacctccagaagattcgattcaaccttatgaaaag
ataaaggccaggggcttacctgataatatatcttctgtgctgaacaagctggtggtggtg
aaactcaatggcggtttgggaaccagcatgggctgcaaaggcccgaaaagtctgattggt
gtgaggaatgagaatacctttttggatctgactgttcagcaaattgaacatttgaacaaa
tcctacaatacagatgttcctcttgttctaatgaactcttttaacacggatgaagataca
aaaaaaattctacagaagtacaatcattgtcgtgtgaaaatctacacttttaatcaaagc
aggtacccaaggattaataaagaatctttactgcctgtagcaaaggatgtgtcatactca
ggggaaaatacagaagcttggtaccctccaggtcatggtgatatttacgccagtttctac
aactctggtttgcttgacacctttataggagaaggcaaagagtatatttttgtgtctaac
atagataatctgggtgccacagtggatctttatattcttaatcatctaatgaacccaccc
aatggaaaaccgtgtgaatttgtcatggaagtcacaaataaaacacgtgcagatgtaaag
ggtgggacacttactcagtatgaaggcaaactgagactggtggaaatcgctcaagtgcca
aaagcacacgttgatgagttcaagtctgtatcaaaattcaaaatatttaacacaaacaac
ctatggatctctcttgcagcagttaaaagactgcaggaacagaatgctattgacatggaa
atcattgtgaatccaaagactttggatggaggcctgaatgttattcagttagaaactgcc
gtgggggctgccattaaaagttttgagaactctctaggtattaatgttcctaggagccgt
tttctgcctgtcaaaactacatcagatctcttgcttgtgatgtcaaacctctatagcctt
aatgcaggatctttgacaatgagtgaaaagagagaatttcctacagtgcccttggttaaa
ttaggcagttcttttacaaaggttcaggattacctaaggagatttgaaagtataccagat
atgcttgaattggatcacctcacagtttcaggagatgtgacatttggcaagaatgtttca
ttaaaggggacagttatcatcatcgcaaatcatggtgaccgaattgacatcccacctgga
gcagtattagagaacaagattgtatctgggaaccttcgtatcttggaccactga

DBGET integrated database retrieval system