KEGG   Equus caballus (horse): 100051906Help
Entry
100051906         CDS       T01058                                 

Gene name
TMX3
Definition
(RefSeq) protein disulfide-isomerase TMX3
  KO
K09585  thioredoxin domain-containing protein 10 [EC:5.3.4.1]
Organism
ecb  Equus caballus (horse)
Brite
Enzymes [BR:ecb01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     100051906 (TMX3)
Chaperones and folding catalysts [BR:ecb03110]
 Protein folding catalysts
  Protein disulfide isomerase
   100051906 (TMX3)
Membrane trafficking [BR:ecb04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   PDI family proteins
    100051906 (TMX3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Thioredoxin_6 Thioredoxin Calsequestrin Thioredoxin_2 Thioredoxin_7 NUDIX_2
Motif
Other DBs
NCBI-GeneID: 100051906
NCBI-ProteinID: XP_001493036
Ensembl: ENSECAG00000024758
VGNC: 24354
UniProt: F6RDS9
Position
8
AA seq 454 aa AA seqDB search
MAAWRRGVALRLCATVVLLDMAFCKGFVEDLDESFKDSRKDDIWLVDFYAPWCGHCKKLE
PIWNEVGLEMKSIGSPVKVGKMDATSYSSIASEFGVRGYPTIKLLKGDLAYNYRGPRTKN
DIIEFAHRVSGALIRPLPSQQMFEHVQKRHRVFFVYIGGESPLKEKYIDAASELIVYTYF
FSASEEVVPEYVTLKEMPAVLVFKDETYFVYDEYEDGDLSSWISRERFQNYLTVDGFLLY
ELGDTGKLVAIAVIDEKNTSTEHTRLKSIIQEVARDYRDQFHRDFQFGHMDGNDYINTLL
MDELKVPTVVVLNTSNQQYFLLDRQITNAEDMVQFINNILDGTVEAQGGDSILQRLKRIV
FDAKSTIVSIFKSSPLMGCFLFGLPLGVISIMCYGIYTADADGGYIEERYEVSRSEIESP
EQIEESKAQQEPRTGDSPVPAVQEPKDVLEKKKD
NT seq 1365 nt NT seq  +upstreamnt  +downstreamnt
atggcagcttggagacgcggggttgccctgcggctctgcgccacagttgttttacttgat
atggctttctgtaaagggtttgtagaagatttagatgaatcgtttaaagacagtcgaaaa
gatgacatttggcttgtagatttttatgcaccatggtgtggccactgtaaaaaactggaa
ccgatttggaatgaagttggtcttgagatgaaaagcattggctctccggttaaagttgga
aagatggatgctacttcttattctagcattgcttcagagtttggagttcgaggttatcca
acaattaagctattaaagggggacttggcatataattatagaggaccacgaactaaaaat
gatattattgagtttgctcacagagtatctggggctctgattcggccacttccaagtcag
caaatgtttgaacatgtgcagaagagacatcgtgtatttttcgtttatataggtggagag
tcacctttgaaggagaaatacatagatgctgcttcagaattaattgtatatacatacttc
ttctctgcctcagaagaagtggttcctgagtatgtgacactgaaagagatgcctgctgtg
cttgttttcaaagatgaaacttactttgtttatgatgagtatgaagatggtgatctgtca
tcttggatcagcagggagaggtttcagaattatcttacagtggatggtttcctcttgtat
gaacttggagatactgggaagctagtggccattgcagtaattgatgagaaaaacacatca
acagaacacaccagattgaagtcaattattcaggaagttgctagagattacagagaccag
ttccacagggattttcagtttggccatatggatggaaatgactatataaataccttgctg
atggatgaattgaaagtcccaactgtggttgtactgaatacttcaaaccaacaatacttt
ttactagacagacagattacgaatgccgaagacatggtccagtttattaataacattttg
gatggcacagtggaagcccaaggaggtgatagcattttgcagagattgaaaagaatagta
tttgatgccaaatctactattgtgtctatattcaagagctctccacttatgggctgcttt
ctctttggcctgccactgggtgtcatcagtatcatgtgctatggaatctacacagctgat
gcagatggaggttatatagaagaacgctatgaagtgtccagaagtgaaattgaaagccca
gaacaaatagaagagagcaaagcacagcaggagccaaggactggggactcgccagtgcct
gcagtgcaagaacccaaagatgtattggaaaagaagaaggattga

DBGET integrated database retrieval system