KEGG   Equus caballus (horse): 100052108
Entry
100052108         CDS       T01058                                 

Definition
(RefSeq) embryonic stem cell-specific 5-hydroxymethylcytosine-binding protein
Organism
ecb  Equus caballus (horse)
SSDB
Motif
Pfam: SRAP
Other DBs
NCBI-GeneID: 100052108
NCBI-ProteinID: XP_005596276
Ensembl: ENSECAG00000022488
UniProt: F7AX17
Position
10
AA seq 350 aa
MCGRTSCHLPRDVLTRACAYRNRQGERRLPEWRDADKYCPSYNKSPRSSSPVLLSRLHFE
KGTDSSERIIVPMRWGLVPSWFKENDPSKLPFNITNCRSDTIMEKRSFNVPLGKGRRCVV
LADGFYEWKRCRGTYDRQPYFIYFPQTKSEKLGSIGAADSPEDWNKVWDNWRLLTMAGIF
DCWEPLQGGDHLYSYTIITVDACKVLNDVHQRMPAILDGEEAVSKWLDFGEVSTQEALKL
IHPTENITFHPVSSVVNSSRNDSVECLAPIDLSVQKELKAKGCSQKMLQWLATKSPKKED
PKTPQKTESDVRQFLPKSPSSVKRSSAVLLEQWLKQEKEEEPVTKQLHSE
NT seq 1053 nt   +upstreamnt  +downstreamnt
atgtgcgggcgaacatcgtgtcacttacctcgagatgtgctcacgagagcgtgtgcctat
cggaaccggcagggcgagcggcggctcccggagtggagggacgctgacaagtattgcccg
tcgtacaacaagagccctcggtcgagcagcccggtgcttctgtctcgactgcactttgag
aagggcacagactcttctgagcgtatcattgttcccatgcgatggggtttggtcccatct
tggttcaaagaaaatgatccttccaagctgccattcaacattaccaattgtcgtagtgat
accataatggagaaacggtccttcaacgtgcctctgggaaagggaagacgctgtgttgtt
ttagcagatggattctacgagtggaagcgatgtcggggaacgtacgacaggcagccatac
tttatctacttcccccaaaccaaatcagaaaagttaggcagcattggtgctgcagacagt
ccagaggactggaacaaagtctgggacaactggaggctgctgacaatggctgggatcttt
gactgctgggagcccctacagggaggagaccacctgtattcctacaccatcatcacagtg
gatgcctgcaaagtcttgaatgacgtccaccaaaggatgcctgccatattagatggagag
gaggcagtctctaaatggcttgattttggtgaagtctcaactcaggaagctctgaagtta
atccaccctacagagaacatcaccttccatccagtctcttctgtggtgaacagctcccga
aacgacagtgttgagtgtctggctcctatcgacttgtcggtccaaaaggaactcaaggca
aaaggctgcagccagaaaatgttgcagtggctggccacaaagtcacccaaaaaggaagac
cccaaaacaccccaaaagacagagtcagatgtgcgccagttcctgccgaagagcccatcc
tcggtcaagagaagcagtgcagttctcctagagcaatggctgaagcaggagaaggaggag
gagcctgtgaccaagcaacttcacagcgagtaa

DBGET integrated database retrieval system