KEGG   Equus caballus (horse): 100052129
Entry
100052129         CDS       T01058                                 

Gene name
AKAP5
Definition
(RefSeq) A-kinase anchor protein 5
  KO
K16522  A-kinase anchor protein 5
Organism
ecb  Equus caballus (horse)
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:ecb01009]
    100052129 (AKAP5)
Protein phosphatases and associated proteins [BR:ecb01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Other calcineurin-interacting proteins
     100052129 (AKAP5)
SSDB
Motif
Pfam: WSK NINJA_B
Other DBs
NCBI-GeneID: 100052129
NCBI-ProteinID: XP_005605292
Ensembl: ENSECAG00000003230
VGNC: 15204
UniProt: F6YIT2
Position
24
AA seq 429 aa
METTVSEIQVESKDEKRPAEVSPQDKRQEEEASMLCFKRRKKPAKAVKPRVGSDAAGVAR
KCPLEAGASDQPQPQVGAWASIKRLVTRRKRSDSSKQQKLFEAKVQPEINAEDADPSKKK
AKSRLKIPCIKFSKGEKRSNHSKIIEDSDCSIRVQGEAESLDTKTLTQSDDQATKTKVTQ
DVSEDVSQKGTDEVCEFNVSNSIISPGETVISVEVGLDMGPSAIQTGTLILEKDIEMTEE
KQSVQPQQASPLEISETEHLLPVVSDVSPSPAIPDQQIVEEARNSILESGPDWKDYESRE
IVAEESKPKDTELSQESGFKENEINAEKPKPEESKRMEPIAIIITDTEISEFDVKKSKNV
PKQFLMSMENEQVGVFANDSGFEGRTSEQYETLLIETASSLVKNAIQLSIEQLVNEMASD
DKKINNLLQ
NT seq 1290 nt   +upstreamnt  +downstreamnt
atggagaccacagtttctgaaattcaagtagaaagcaaggatgagaagagaccagcagaa
gttagtcctcaggataagaggcaggaagaagaggcatcgatgctttgcttcaagagaaga
aagaaaccagccaaagcggtgaagcccagagtcggctctgacgctgctggtgtggcaagg
aagtgtcccctagaagcaggcgcttctgatcagccacaaccccaagtgggggcctgggcc
tcaatcaaacgtcttgtaacacgcaggaaaaggtcagattcttcaaagcagcagaagctc
tttgaggctaaagtgcaacctgaaatcaatgctgaagatgctgatccttctaagaaaaag
gcaaaatccagacttaagattccctgcataaaattctccaaaggggagaaaagaagtaat
cattccaaaattattgaagactcagactgcagcatcagagtccagggagaagctgaaagt
ttggatacaaaaactctgacccaatcagatgaccaggccacaaagaccaaggtcacccag
gatgtaagtgaagatgtctctcagaaagggactgatgaggtctgtgaattcaatgtgagc
aacagcataatttctcctggagagacagtgatttcagtagaagttgggttagatatgggg
ccttctgctattcaaacaggaactctaattcttgaaaaagatattgagatgactgaggaa
aagcaaagtgttcaaccccagcaggcaagcccacttgaaatttcagaaacagaacacctg
ctaccagtggtttctgatgtttcgccctcacctgcaatcccagatcaacaaattgtggaa
gaagccagaaacagtatcctagaaagtggaccagattggaaagactatgaaagtagagag
attgtagctgaagagagtaagccaaaagacactgaattgagccaggaatcaggctttaaa
gaaaatgagatcaatgcagagaaacccaaaccagaagaaagcaaaagaatggagccaatt
gctattattattacagacactgaaatcagtgaatttgatgttaagaaatctaaaaatgtc
cctaagcaattcttaatgtcaatggaaaatgagcaagtaggagtttttgctaatgacagt
ggttttgaaggtagaacttcagaacaatatgaaacacttttaatagaaacagcctcttct
cttgtcaagaatgctatccagttgtctatagaacagctcgtcaatgaaatggcctctgat
gacaagaaaataaacaaccttctacagtga

DBGET integrated database retrieval system