KEGG   Equus caballus (horse): 100052197
Entry
100052197         CDS       T01058                                 

Gene name
DPEP1
Definition
(RefSeq) dipeptidase 1
  KO
K01273  membrane dipeptidase [EC:3.4.13.19]
Organism
ecb  Equus caballus (horse)
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:ecb01002]
    100052197 (DPEP1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ecb04147]
    100052197 (DPEP1)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:ecb00537]
    100052197 (DPEP1)
Enzymes [BR:ecb01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.13  Dipeptidases
    3.4.13.19  membrane dipeptidase
     100052197 (DPEP1)
Peptidases and inhibitors [BR:ecb01002]
 Metallo peptidases
  Family M19: membrane dipeptidase family
   100052197 (DPEP1)
Exosome [BR:ecb04147]
 Exosomal proteins
  Proteins found in most exosomes
   100052197 (DPEP1)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:ecb00537]
 Enzymes
  100052197 (DPEP1)
SSDB
Motif
Pfam: Peptidase_M19 baeRF_family2
Other DBs
NCBI-GeneID: 100052197
NCBI-ProteinID: XP_001488357
Ensembl: ENSECAG00000022966
VGNC: 49047
UniProt: F6TJM7
Position
3
AA seq 410 aa
MWTSWWLWPLVAICTADQFRDQAERIMQGTPVIDGHNDLPWQLLKMFNNQLRDERANLTT
LASTHTNIPKLKAGFVGGQFWSAYVPCDTQNKDAVRRTLEQIDVVHRMCQMYPETFVCVT
NSTGIRQAFQEGRVASLVGVEGGHSIDSSLAVLRALYHLGMRYLTLTHSCNTPWADNWLV
DTGEDKAQSQGLSLFGQTVLKEMNRLGVMIDLAHVSVATMKAALELSKAPVIFSHSSAYS
LCAHRRNVPDDVLQLVKQTGSLVMVNFYNDYVACQREANLSQVADHLDYIKNVAGAEAVG
FGGDYDGVSRVPSGLEDVSKYPDLVAELLRRQWTEAEIRGALADNLLRVFEAVEEASDHM
QTPEEEPIPLDKLEPSCRTKYGYSQAPSLHRQLGALLASLALLPLGLCLL
NT seq 1233 nt   +upstreamnt  +downstreamnt
atgtggaccagctggtggctctggcccttggtggccatctgtactgcagaccagttccgg
gaccaggcagaaagaatcatgcagggtacacctgtcattgacgggcacaacgacctgccc
tggcagctgctgaagatgttcaacaaccagcttcgggatgagcgggccaacctgaccacg
ctggcctccacgcacaccaacatccccaagctgaaggctggttttgttgggggccagttc
tggtccgcatacgtaccctgcgacacccagaacaaggatgctgtgcggaggacactggag
cagatagatgtcgtccaccgcatgtgtcagatgtaccccgagacctttgtgtgtgtcacc
aacagcacaggcatccgccaggccttccaggaaggaagggtggccagcctggtgggcgtg
gagggcggccactccatcgacagcagcctcgctgtcctgcgggcactctaccacctgggc
atgcggtacctcaccctcactcacagctgcaacacaccctgggccgacaactggctggtg
gacacgggggaagacaaggcccagagccaaggcctgtcgctctttgggcagactgtgctg
aaggagatgaaccggctaggcgtcatgatcgacttggcccacgtgtctgtggccaccatg
aaggccgctctagagctctccaaggcccccgtcatcttcagccactcctcagcctacagt
ctgtgtgcgcacaggcgcaacgtgcccgacgacgtgcttcagttggtgaagcagacaggc
agcctggtgatggtcaacttctacaacgactacgttgcctgccaaagggaggccaacctg
tcccaagtagcagaccacctggactacatcaagaacgtggcgggagctgaggccgtgggc
tttggtggggactatgatggtgtttcaagggttccctcagggttggaggacgtgtccaag
tacccagacctggtcgccgagctgctcaggagacagtggacggaggcagagatcaggggc
gccctggctgacaacctgctgagggtcttcgaggcagtggaggaggcgagcgaccatatg
cagactccagaggaagagcccatcccactggacaagctggagccttcctgcaggaccaag
tatgggtactcacaggcccccagcctccaccgccagctgggggccctgctggcctccctc
gccctgctccccctcggcctgtgtcttctatga

DBGET integrated database retrieval system