KEGG   Equus caballus (horse): 100052300Help
Entry
100052300         CDS       T01058                                 

Gene name
CAMK1
Definition
(RefSeq) calcium/calmodulin-dependent protein kinase type 1 isoform X1
  KO
K08794  calcium/calmodulin-dependent protein kinase I [EC:2.7.11.17]
Organism
ecb  Equus caballus (horse)
Pathway
ecb04020  Calcium signaling pathway
ecb04921  Oxytocin signaling pathway
ecb04925  Aldosterone synthesis and secretion
ecb05214  Glioma
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    100052300 (CAMK1)
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    100052300 (CAMK1)
   04925 Aldosterone synthesis and secretion
    100052300 (CAMK1)
 09160 Human Diseases
  09162 Cancer: specific types
   05214 Glioma
    100052300 (CAMK1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ecb01001]
    100052300 (CAMK1)
Enzymes [BR:ecb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     100052300 (CAMK1)
Protein kinases [BR:ecb01001]
 Serine/threonine kinases: CAMK group
  CAMK1 family [OT]
   100052300 (CAMK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Pkinase_fungal Kdo APH RIO1 Tyrosinase
Motif
Other DBs
NCBI-GeneID: 100052300
NCBI-ProteinID: XP_005600446
Ensembl: ENSECAG00000023628
VGNC: 16019
UniProt: F6YNX6
Position
16
AA seq 412 aa AA seqDB search
MGGAAREGWTLDGQGWALLPPLCSRPSRCQAGVLAVAGGQWAMPGEVKGPSWKQAEDIRD
IYDFRDVLGTGAFSEVILAEDKRTQKLVAIKCIAKKALEGKEGSMENEIAVLHKIKHPNI
VALDDIYESGGHLYLVMQLVSGGELFDRIVEKGFYTERDASRLIFQVLDAVKYLHDLGIV
HRDLKPENLLYYSLEEDSKIMISDFGLSKMEDPGSVLSTACGTPGYVAPEVLAQKPYSKA
VDCWSIGVIAYILLCGYPPFYDENDAKLFEQILKAEYEFDSPYWDDISDSAKDFIRHLME
KDPEKRFTCEQALQHPWIAGDTALDKNIHQSVSEQIKKNFAKSKWKQAFNATAVVRHMRK
LQLGTSQEGQGQTASHGELLTPAAGGPAAGCCCRDCCVEPGPELSPSLPSQL
NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt
atgggaggagctgcccgggagggctggactctggatgggcagggctgggcccttctcccc
ccactctgctccaggcccagcaggtgccaggcaggagtcctggctgtggccggggggcag
tgggccatgccgggggaagtgaaaggccccagctggaagcaggcagaagacattagggac
atttacgacttccgagatgttctaggaacgggggccttctccgaggtgatcctggcagaa
gataagaggactcagaagctggtggccatcaaatgcatcgccaagaaggctctggagggc
aaggagggcagcatggagaacgagatcgctgtcctgcacaagatcaagcaccccaacatt
gttgccctggatgacatctatgagagtgggggccacctctacctcgtcatgcagctggtg
tcgggcggggaactgtttgaccgcattgtggaaaaaggcttctacacagagcgggatgcc
agccgcctcatcttccaggtgctggatgcagtcaagtacctgcacgacctgggcattgta
caccgggacctcaagccagagaatctgctgtactacagcctggaggaagactccaagatc
atgatctctgactttggcctttccaaaatggaggaccctggcagcgtgctctccacagcc
tgcgggaccccaggatacgtggcccctgaggtcctggcccagaagccctacagcaaggca
gtggattgctggtccattggcgtcattgcctacatcctgctctgcggttacccccccttc
tacgacgagaatgatgccaaactctttgaacagatattaaaggccgagtacgagttcgac
tctccttactgggacgacatctctgactctgctaaagacttcatccggcacttgatggag
aaggatccagagaagaggttcacctgtgagcaggccttgcagcacccgtggattgcagga
gatactgctctagataagaatattcaccagtcagtgagtgagcagatcaagaagaacttt
gccaagagcaagtggaagcaagccttcaatgctacggccgtggtgcggcacatgaggaag
ctacagctgggcaccagccaggaggggcagggacagacggcgagccacggggagctgctg
actccagcagctggggggccagcggctggctgctgctgtcgagactgctgcgtggagcca
ggcccagagctgtccccctccctgccctcccagctctag

DBGET integrated database retrieval system