KEGG   Equus caballus (horse): 100052628Help
Entry
100052628         CDS       T01058                                 

Gene name
TACC3
Definition
(RefSeq) transforming acidic coiled-coil-containing protein 3 isoform X2
  KO
K14283  transforming acidic coiled-coil-containing protein 3
Organism
ecb  Equus caballus (horse)
Pathway
ecb03013  RNA transport
Brite
KEGG Orthology (KO) [BR:ecb00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    100052628 (TACC3)
Messenger RNA biogenesis [BR:ecb03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     100052628 (TACC3)
   mRNA cycle factors
    P-body specific factors
     100052628 (TACC3)
Chromosome and associated proteins [BR:ecb03036]
 Eukaryotic Type
  Sister chromatid separation proteins
   TACC proteins
    100052628 (TACC3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TACC Linker_histone DUF1481
Motif
Other DBs
NCBI-GeneID: 100052628
NCBI-ProteinID: XP_005609001
Ensembl: ENSECAG00000011380
VGNC: 23839
Position
3
AA seq 794 aa AA seqDB search
MSLQIFSDENVTGDKSAENCDFLFSPPELTGRSSVLRLSQKENVPPKSIAKAVKVTFQTP
LRDPQTHRVLSPVVSSKPEACFALGEARGLGNPPHVWTQKENQQLTKEVDTKTTDGILQK
PAVVDADPPPGNMRPASEDRHSGGPTSAPLALLNPSSSPQTLESLKNQVPSPGRMSGSPE
QDLEANVRSYSLEKSIMSTPEILEDPPGMVPQDRTADPHTVAGGSSHRIPASAAGATLPA
GGAPEGAHGEGPLADLPGEAPADPENTTQAGPLGAGGTTSPSPQEEEADSQKADSWRSGP
IRLEFDFSDEAASKRPPPPRKLGKRPGLKAPSRRPEGRQEKSPREVGEGPVPPPGGSYNL
DCDKLDDPNVSPFGGGGEAWPSERPQDGSAGPGAAQLSTGPAAVENSPPNQQVPSASADD
TPVVQTAAETSGAVGKEGTVNSSGTLAPTSSPCSELTASPTKPASPPLQGPEPASDLSDE
HFRDPAEVLGAGAEVDYLEQFGTCLFKESALRKQSLYLKFDPLLMDSPQRPAPVVPATDS
VQDVDAPSGNPPAANLVELDFLGPPDVPVLDPPLCVLGPGGPLLPVGPIVDVLQYSQKDL
DAVVEATQKENLSLRSECEALQAKNLEMGKIMDGFERMVYQAMEEAQKQKELAKAEIQKV
LKEKDQLTADLSSLEKSFSDLFKRFEKQKEVIEGYRTNEESLKKCVEDYIVRIEKEGQRY
YALKAHAEEKLKLANEEIAQVRSKAQAEALAFQASLRKEQMRIHSLEKTVEQKTKENDEL
TRICDDLISKMEKI
NT seq 2385 nt NT seq  +upstreamnt  +downstreamnt
atgagtctgcagatcttcagtgacgaaaatgtcactggtgacaaaagtgcagagaactgt
gacttcctgttttcaccaccagagcttaccggaagatcatctgttcttcgtctgtcacag
aaagaaaatgtgccccccaagagcatagcaaaagctgtgaaggtgacttttcagacgcct
ctgcgggacccacagacgcacagggttttaagtcctgttgtgagcagcaaaccggaggct
tgctttgctctgggtgaggccagagggttaggaaaccctcctcacgtctggacgcagaaa
gagaaccaacagttgaccaaagaagtggacaccaaaacaaccgatggaattctccagaaa
ccagcagtggtggatgctgaccctcctccagggaacatgagaccagcctctgaagacagg
cattctggcgggcccacctcagctcccctggccctcttgaatccctcaagctctccccag
acgctggaaagtcttaaaaaccaagtgccatctccaggacgaatgtctggcagccctgag
caagacttggaggcaaacgttcgttcttattccttagagaaaagcattatgtccacccct
gaaattctagaagaccctcctgggatggtgccccaagatagaactgcagaccctcacaca
gtggcaggaggaagctcgcacaggatccctgcttccgcagccggggccactctgcctgct
ggaggtgcccccgaaggagcacatggagaagggccccttgcagacctgcctggcgaggcc
cctgccgaccccgagaataccacccaggctggccctctgggggctggaggcaccacgtcc
ccaagtcctcaggaggaagaggccgacagccaaaaggctgactcttggaggagcgggccc
ataaggctagaatttgacttctccgacgaggctgccagcaaaaggccacccccaccaagg
aagctggggaagagacctggcctcaaggctccctcacggaggccggaggggaggcaggaa
aagagccccagggaggtgggtgagggtcccgttccccctcccggggggtcttacaacctg
gactgcgacaagttggatgacccaaacgtcagcccgtttggaggcggtggggaggcttgg
ccctcagaacgcccccaggacggatccgccgggcccggggccgcacagctgagcactggg
cctgcggccgtggagaactcacctccaaaccagcaggtgccttcagcctccgcagatgac
acacctgtggtgcagaccgcagcagagacctcaggagcagtcggcaaggaaggaactgtg
aattcttcgggcacattggctcccaccagcagtccatgcagtgagctgacggcctcaccc
actaaaccggcgtccccacctctgcaggggccagagccagcctcagacctgagtgacgag
cacttccgagacccagctgaggttctaggtgcaggagccgaggtggactacctggagcag
ttcgggacttgcttgtttaaagagtcagccctgaggaagcagtccttatacctcaagttc
gacccgctcctgatggacagccctcagagacctgcgcccgtggtccccgcgacagacagt
gtgcaggacgtggacgcgccctcgggaaatccgcctgccgccaatctcgtggaacttgac
ttcctaggccctccggatgtgcctgtgctggacccacctttgtgtgtcctcgggcccggg
ggtccactgctgcccgtgggacccatcgtggacgtactacagtacagccagaaggacctg
gatgctgtggtggaagcaacacaaaaagagaacctgtcgctcaggagcgagtgtgaggcg
ctccaggcgaagaacctggagatggggaagatcatggatgggtttgagaggatggtgtac
caggcgatggaggaggctcagaaacagaaggaacttgccaaagctgagatccagaaggtt
ctcaaagagaaagaccaactgactgcagacctgagctccttggaaaagtctttctctgac
ctcttcaagcggttcgagaaacagaaggaggtgatcgaaggctaccgcacgaatgaagaa
tcgctgaagaagtgcgttgaggattacatagtgagaattgaaaaggaaggccagagatac
tacgcgctaaaggcccacgcggaagagaaactcaagctggcaaacgaggagatcgcccag
gtccggagcaaggcccaagcagaggccctggccttccaggcgagcctgaggaaggagcag
atgcgcatccactcgctggagaagaccgtggagcagaagactaaagaaaacgatgagctg
accagaatctgtgacgacctcatatccaagatggaaaagatctga

DBGET integrated database retrieval system