KEGG   Equus caballus (horse): 100052829
Entry
100052829         CDS       T01058                                 

Gene name
C6H12orf57
Definition
(RefSeq) protein C10
Organism
ecb  Equus caballus (horse)
SSDB
Motif
Pfam: P_C10 FAST_2
Other DBs
NCBI-GeneID: 100052829
NCBI-ProteinID: XP_001497722
Ensembl: ENSECAG00000024869
VGNC: 52341
UniProt: F6Q737
Position
6
AA seq 126 aa
MASSSAQPAALSAEQAKVVLAEVIQAFSAPENAVRMDEARDNACNDMGKMLQFVLPVATQ
IQQEVIKAYGFSCDGEGVLKFARLVKSYEAQDPEIASLSGKLKALFLPPMTLPPHGPASG
GSVAAS
NT seq 381 nt   +upstreamnt  +downstreamnt
atggcgtcctcctcggcccaacctgcggccctgagcgccgaacaggccaaggtggtcctg
gccgaggtgatccaggcgttctcggccccagagaatgccgtgcgcatggacgaggctcgg
gacaacgcatgcaacgacatgggcaagatgctgcaatttgtgctgcctgtggccacgcag
attcagcaggaggttatcaaagcctatggcttcagctgcgacggggaaggtgtcctcaag
tttgcccgcttggtcaagtcttacgaagctcaggatcctgagattgccagcctgtcaggc
aagctgaaggcactgttcctgccgcctatgacactgccgccccacgggcctgcttcaggc
ggcagcgtggccgcctcctga

DBGET integrated database retrieval system