KEGG   Equus caballus (horse): 100052889Help
Entry
100052889         CDS       T01058                                 

Definition
(RefSeq) histone H2B type 1-N
  KO
K11252  histone H2B
Organism
ecb  Equus caballus (horse)
Pathway
ecb05034  Alcoholism
ecb05203  Viral carcinogenesis
ecb05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:ecb00001]
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    100052889
  Immune diseases
   05322 Systemic lupus erythematosus
    100052889
  Substance dependence
   05034 Alcoholism
    100052889
Chromosome and associated proteins [BR:ecb03036]
 Eukaryotic Type
  Nucleosome assembly factors
   Histones
    100052889
Exosome [BR:ecb04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100052889
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Histone CBFD_NFYB_HMF TFIID_20kDa YscO-like
Motif
Other DBs
NCBI-GeneID: 100052889
NCBI-ProteinID: XP_003363834
Ensembl: ENSECAG00000005124
UniProt: F6PWV1
Position
20
AA seq 126 aa AA seqDB search
MPEPSKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAM
GIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVT
KYTSSK
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atgcctgaaccttctaagtcggcccctgctccgaagaagggctccaagaaggcggtgacc
aaggcgcagaagaaggacggcaagaagcgcaagcgcagccgcaaggagagctactccgtc
tacgtgtacaaggtgctgaagcaggtccaccccgacaccggcatctcgtccaaggccatg
ggcatcatgaactcgttcgtcaacgacatcttcgagcgcatcgcgggcgaggcgtcgcgc
ctggcgcattacaacaagcgctcgaccatcacctccagggagatccagacggccgtgcgc
ctgctgctgcccggggagctggccaagcacgccgtgtccgagggcaccaaggccgtcacc
aagtacaccagctccaagtga

DBGET integrated database retrieval system