KEGG   Equus caballus (horse): 100053104Help
Entry
100053104         CDS       T01058                                 

Gene name
ST3GAL3
Definition
(RefSeq) CMP-N-acetylneuraminate-beta-1,4-galactoside alpha-2,3-sialyltransferase isoform X3
  KO
K00781  neolactotetraosylceramide alpha-2,3-sialyltransferase (sialyltransferase 6) [EC:2.4.99.6]
Organism
ecb  Equus caballus (horse)
Pathway
ecb00514  Other types of O-glycan biosynthesis
ecb00515  Mannose type O-glycan biosynthesis
ecb00533  Glycosaminoglycan biosynthesis - keratan sulfate
ecb00601  Glycosphingolipid biosynthesis - lacto and neolacto series
ecb01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00515 Mannose type O-glycan biosynthesis
    100053104 (ST3GAL3)
   00514 Other types of O-glycan biosynthesis
    100053104 (ST3GAL3)
   00533 Glycosaminoglycan biosynthesis - keratan sulfate
    100053104 (ST3GAL3)
   00601 Glycosphingolipid biosynthesis - lacto and neolacto series
    100053104 (ST3GAL3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:ecb01003]
    100053104 (ST3GAL3)
Enzymes [BR:ecb01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.99  Transferring other glycosyl groups
    2.4.99.6  N-acetyllactosaminide alpha-2,3-sialyltransferase
     100053104 (ST3GAL3)
Glycosyltransferases [BR:ecb01003]
 Terminal extension
  Sialyltransferase
   100053104 (ST3GAL3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_transf_29
Motif
Other DBs
NCBI-GeneID: 100053104
NCBI-ProteinID: XP_005607179
Ensembl: ENSECAG00000012021
VGNC: 23629
Position
2
AA seq 358 aa AA seqDB search
MGLLVFVRNLLLALCLFLVLGFLYYSVWKLHLLQWEDSKYDRLGFLLKLDSKLPPELATK
YANFSEGTCKPGHASALMTAIFPRFSKPAPMFLDDSFRMWARIQEFVPPFGIKGQDKLIR
AILSVTKEYHLTPALDSLSCRRCIIVGNGGVLANKSLGSRIDDYDIVVRLNSAPVKGFEK
DVGSKTTLRITYPEGAMQQPEQYERDSLFVLAGFKWQDFRWLKYIVYKERMSALDGFWKS
VATRVPKEPPEIRILNPYFIQEAAFNLIGLPFNNGLMGRGNIPTLGSVAVTMALHGCDEV
AVAGFGYDMSTPNAPLHYYETVRMAAIKESWTHNIQREKDFLRKLVKAHVITDLTSGI
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atgggactcttggtatttgtacgcaatctgctgctagccctctgcctttttctagtactg
ggatttttgtattattctgtgtggaagctgcatttactccagtgggaggactccaagtat
gatcgattgggcttcctcttgaagctggactctaaactgcctcctgagttagccaccaag
tacgcaaacttttcagagggaacttgcaagcctggacatgcttcagccttgatgactgcc
atcttcccccggttctccaagccagcacccatgttcctggatgactccttccgcatgtgg
gctaggatccaggaatttgtgccgccttttgggatcaaaggtcaagacaagctgatcaga
gccatcttgtcagtcaccaaagagtaccacctgacccctgccttggacagcctcagttgc
cgccgctgcatcatcgtgggaaatggaggtgtccttgccaacaagtctctggggtcacga
attgatgactatgacattgtggtcagactgaactcagcaccagtgaaaggctttgagaag
gacgtgggcagcaaaacgaccctgcgcatcacctaccctgagggcgccatgcagcagccc
gagcagtacgaacgggattctctctttgtcctcgctggcttcaagtggcaggacttcagg
tggttgaagtacatcgtctacaaggagagaatgagtgcattggatggcttctggaaatct
gtggccactcgagtgcccaaggagccccctgagattcgcattctcaacccgtatttcatc
caggaggctgccttcaacctcatcggactgcccttcaacaatggcctcatgggccggggg
aacatcccgacccttggcagtgtggcagtgaccatggcactacacggctgtgatgaggtg
gcagttgcaggttttggctacgacatgagcacgcccaacgcacccctgcactactatgag
actgtgcgcatggccgccatcaaagagtcctggacacacaatattcagcgagaaaaagac
tttctgcggaagctggtgaaagcgcatgtcatcactgacttaaccagtggcatctga

DBGET integrated database retrieval system