KEGG   Equus caballus (horse): 100053753
Entry
100053753         CDS       T01058                                 

Gene name
LCAT
Definition
(RefSeq) phosphatidylcholine-sterol acyltransferase isoform X2
  KO
K00650  lecithin-cholesterol acyltransferase [EC:2.3.1.43]
Organism
ecb  Equus caballus (horse)
Pathway
ecb00564  Glycerophospholipid metabolism
ecb04979  Cholesterol metabolism
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    100053753 (LCAT)
 09150 Organismal Systems
  09154 Digestive system
   04979 Cholesterol metabolism
    100053753 (LCAT)
Enzymes [BR:ecb01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.43  phosphatidylcholine---sterol O-acyltransferase
     100053753 (LCAT)
SSDB
Motif
Pfam: LCAT Abhydrolase_6 Hydrolase_4 Ser_hydrolase LD_cluster2
Other DBs
NCBI-GeneID: 100053753
NCBI-ProteinID: XP_001498513
Ensembl: ENSECAG00000022392
VGNC: 19606
UniProt: F6ZJP9
Position
3
AA seq 440 aa
MGPPGSPWQWVLLLLGLLLPSAAPFWLLNVLFPPHTTPKAELSNHTRPVILVPGCLGNQL
EAKLDKPDVVNWMCYRKTEDFFTIWLDLNMFLPLGVDCWIDNTRVVYNRSSGRVSNAPGV
QIRVPGFGKTYSVEYLDTSKLAGYMHTLVQNLVNNGYVRDETVRAAPYDWRLEPSQQEEY
YGKLAGLVEEMHATYGKPVFLIGHSLGCLHLLYFLLRQPQSWKDRFIDGFISLGAPWGGS
IKPMLVLASGDNQGIPIMSSIKLKEEQRMTTTSPWMFPSSRAWPEDHVFISTPSFNYTGR
DFQRFFTDLHFEEGWYMWLQSRDLLAGLPAPGVEVYCLYGVGLPTPSTYIFDHGFPYTDP
VGVLYEDGDDTVATRSTELCARWQGRQPQPVHLLPLHGIQHLNMVFSNQTLEHVNAILLG
TYRRSSPASPAASREPLPPE
NT seq 1323 nt   +upstreamnt  +downstreamnt
atggggccgcccggctccccatggcagtgggtgctgctgctgctggggctgctgctccct
tctgctgcccccttctggctcctcaatgtgctcttccccccgcacaccacgcccaaggct
gagctcagtaaccacacacggcccgtcatcctcgtgcctggctgcctggggaatcagctg
gaagccaagctggataaaccagatgtggtgaactggatgtgctaccgcaagacagaagac
ttcttcaccatctggctggatctcaatatgttcctaccccttggggtagactgctggatc
gataacaccagggttgtctacaaccgcagctctgggcgtgtgtccaatgcccctggtgta
cagatccgtgtccctggctttggcaagacctactctgtcgagtacctggacactagcaag
ctggcaggttacatgcacacactggtgcagaatctggtcaacaatgggtatgtgcgggat
gagacagtgcgggctgccccctacgactggcggctggagcccagccagcaggaggaatac
tacgggaagctcgctgggctggtagaggagatgcatgctacttatggaaagcctgtcttc
cttattgggcacagtcttggctgcctgcacttgctctatttcttgctgcgccagccccag
tcctggaaggaccgcttcattgatggcttcatctctcttggggctccctggggtggctcc
atcaagcccatgttggtcttggcctcaggtgacaaccagggcatcccgatcatgtccagc
atcaagctgaaagaggagcagcgcatgacaacaacctccccatggatgtttccctccagc
cgggcatggcctgaggaccatgtgttcatttccacgcccagcttcaactacacaggccgt
gacttccagcgcttctttacagacttgcactttgaggaaggctggtacatgtggctacag
tcacgtgacctgctcgcaggcctcccagcacctggtgtggaagtatattgtctgtatggc
gtgggcctgcccacgcccagcacctacatctttgaccatggcttcccctacacggaccct
gtgggtgtgctctatgaggacggtgatgacactgtggccacacgcagcaccgagctctgt
gcccgctggcagggccgccagccacagcctgtgcacctgctgccactgcatgggatacag
cacctcaacatggtcttcagcaaccagacactggagcacgtcaatgccatcctgctgggt
acctaccgacgtagcagccctgcatccccagctgccagccgagagcccctgccccctgaa
taa

DBGET integrated database retrieval system