KEGG   Equus caballus (horse): 100053785Help
Entry
100053785         CDS       T01058                                 

Gene name
MGLL
Definition
(RefSeq) monoglyceride lipase isoform X2
  KO
K01054  acylglycerol lipase [EC:3.1.1.23]
Organism
ecb  Equus caballus (horse)
Pathway
ecb00561  Glycerolipid metabolism
ecb01100  Metabolic pathways
ecb04714  Thermogenesis
ecb04723  Retrograde endocannabinoid signaling
ecb04923  Regulation of lipolysis in adipocytes
Module
ecb_M00098  Acylglycerol degradation
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    100053785 (MGLL)
 09150 Organismal Systems
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocyte
    100053785 (MGLL)
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    100053785 (MGLL)
  09159 Environmental adaptation
   04714 Thermogenesis
    100053785 (MGLL)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:ecb01002]
    100053785 (MGLL)
Enzymes [BR:ecb01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     100053785 (MGLL)
Peptidases [BR:ecb01002]
 Serine Peptidases
  Family S33
   100053785 (MGLL)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hydrolase_4 Abhydrolase_6 Abhydrolase_1 Esterase Lipase_3 Abhydrolase_5 Abhydrolase_3 DLH Peptidase_S9 LIDHydrolase PGAP1 Thioesterase BAAT_C DUF1057
Motif
Other DBs
NCBI-GeneID: 100053785
NCBI-ProteinID: XP_001488869
Ensembl: ENSECAG00000007658
VGNC: 20161
Position
16
AA seq 346 aa AA seqDB search
MPPCDRRDEGAAVICLALILEAVVAVECKSQDMMEPGLEDPLTMPEESCLRQTPQKIPYR
DLPHLVNADGLYLFCKYWKPTGTPKALIFVSHGAGEHCGRYDELAQMLVGLGLLVFAHDH
VGHGQSEGERMVVSDFHVFVRDVLQHVDIMQKDYPGIPVFLLGHSMGGAIVILTAAERPG
HFSGMVLISPLVLANPESATTFKVLAAKVLNLVLPNMSLGPIDASMLSRNKTEVDLYNAD
PLICRAGLKVCFGIQLLNAVSRVERALPKLTLPFLLLQGSADRLCDSKGAYLLMESSKSQ
DKTLKIYEGAYHVLHKELPEVTNSVFREINMWVSQRTAATERGSPP
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgccgccctgtgaccgccgagatgagggagcagccgttatttgcctggccctgattctc
gaggctgtcgtggctgtggaatgcaaaagccaggacatgatggaaccagggcttgaggat
cctctcacgatgccggaggaaagttgtctcaggcagaccccgcagaagattccgtaccgg
gacctccctcacctggtcaacgctgacgggctgtacctcttctgcaagtactggaagccg
actggcacacccaaggccctcatctttgtgtcccatggcgctggggaacactgcggccgc
tatgatgagctggctcagatgctggtggggctggggctgctggtgtttgcccacgaccac
gttggccacggacagagcgaaggggagaggatggtcgtgtctgacttccacgttttcgtc
agggatgtgctccagcacgtggatatcatgcagaaagactatcccgggatccctgtcttc
cttctgggccactccatgggaggtgccatcgtcatcctcacagccgcagagaggccaggc
cacttctctggcatggttctcatttcacctttggttcttgccaatcctgagtcggccacc
actttcaaggtccttgctgcaaaagttctcaaccttgtcctgccaaacatgtccctgggc
ccgattgacgccagcatgctctctcggaataagacggaggtcgacctttataacgcggac
cccctcatctgccgggcagggctgaaggtatgcttcggcatccagcttctcaatgccgtc
tcgcgggtagagcgggccctccccaagctgacgttgcccttcctgctgctccagggctct
gctgaccgcctgtgcgacagcaaaggagcctacttgctcatggagtcctccaagagccag
gacaagacacttaagatttacgaaggtgcctaccacgttctccacaaagagcttcctgaa
gtaaccaactccgtcttccgtgaaatcaacatgtgggtctctcaaaggactgcggcgaca
gagagggggtccccgccctga

DBGET integrated database retrieval system