KEGG   Equus caballus (horse): 100053978Help
Entry
100053978         CDS       T01058                                 

Definition
(RefSeq) late histone H2B.L4-like
  KO
K11252  histone H2B
Organism
ecb  Equus caballus (horse)
Pathway
ecb05034  Alcoholism
ecb05203  Viral carcinogenesis
ecb05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:ecb00001]
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    100053978
  Immune diseases
   05322 Systemic lupus erythematosus
    100053978
  Substance dependence
   05034 Alcoholism
    100053978
Chromosome and associated proteins [BR:ecb03036]
 Eukaryotic Type
  Nucleosome assembly factors
   Histones
    100053978
Exosome [BR:ecb04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100053978
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Histone CBFD_NFYB_HMF TAF
Motif
Other DBs
NCBI-GeneID: 100053978
NCBI-ProteinID: XP_001488950
Position
X
AA seq 174 aa AA seqDB search
MLSNQIGSLPVTSERRLYKRATVPEEPPFSFLGDCPGTACDMAEPVAEPSSEESLGTTEP
AEADPKSPKQKQPRPRRHRRRCLDSFATYFPRVLRRVHEGLSLSQEAVSVLDSFVKDIFE
RIAGEAALLARSTKRSTISSREIQTAVRLLLPGEIGKHAVSEASKAVLRYTNRR
NT seq 525 nt NT seq  +upstreamnt  +downstreamnt
atgctatccaatcagatagggagcttgcccgtgacgtcagagaggcggctctataaaagg
gccaccgtccctgaggagccgccgttctccttccttggagactgccctggcaccgcctgt
gacatggctgagcctgtcgctgagccttcctctgaggaaagcctgggcaccacggagccc
gcggaagccgacccgaagagcccgaagcagaagcagccaaggccccgccgccaccgccgc
cgctgcctcgacagtttcgccacctatttccccagggttctgaggcgggttcacgagggc
ctgagcctgtctcaggaggccgtgagcgtcctggattccttcgtgaaggacatcttcgag
cgcatcgccggcgaggccgcgctcctggcccgctccaccaagcgctccaccatctcgtcc
agagagattcagaccgccgtgcgcctgctgctgccgggggagattggcaagcacgccgtg
tctgaggccagcaaggccgtccttaggtacaccaaccgccgctga

DBGET integrated database retrieval system