KEGG   Equus caballus (horse): 100054178
Entry
100054178         CDS       T01058                                 

Gene name
NEFL
Definition
(RefSeq) neurofilament light polypeptide
  KO
K04572  neurofilament light polypeptide
Organism
ecb  Equus caballus (horse)
Pathway
ecb05014  Amyotrophic lateral sclerosis
ecb05022  Pathways of neurodegeneration - multiple diseases
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    100054178 (NEFL)
   05022 Pathways of neurodegeneration - multiple diseases
    100054178 (NEFL)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:ecb01009]
    100054178 (NEFL)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:ecb04812]
    100054178 (NEFL)
Protein phosphatases and associated proteins [BR:ecb01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     100054178 (NEFL)
Cytoskeleton proteins [BR:ecb04812]
 Eukaryotic cytoskeleton proteins
  Intermediate filaments
   Intermediate filaments
    Type IV
     100054178 (NEFL)
SSDB
Motif
Pfam: Filament Filament_head TPR_MLP1_2 Lectin_N DUF1664
Other DBs
NCBI-GeneID: 100054178
NCBI-ProteinID: XP_005607746
Ensembl: ENSECAG00000022890
VGNC: 20662
UniProt: F6W6H2
Position
2
AA seq 572 aa
MSSFSYEPYYSTSYKRRYMETPRVHISSVRSGYSTARSAYSSYSAPVSSSLSVRRSYSSS
SGSLMPSLENLDLSQVAAISNDLKSIRTQEKAQLQDLNDRFASFIERVHELEQQNKVLEA
ELLVLRQKHSEPSRFRALYEQEIRDLRLAAEDATNEKQALQGEREGLEETLRNLQARYEE
EVLSREDAEGRLMEARKGADEAALARAELEKRIDSLMDEIAFLKKVHEEEIAELQAQIQY
AQISVEMDVSSKPDLSAALKDIRAQYEKLAAKNMQNAEEWFKSRFTVLTESAAKNTDAVR
AAKDEVSESRRLLKAKTLEIEACRGMNEALEKQLQELEDKQNADISAMQDTINKLENELR
TTKSEMARYLKEYQDLLNVKMALDIEIAAYRKLLEGEETRLSFTSVGSITSGYTQTSQVF
GRSAYGGLQTSSYLMSARSFPTYYTSHVQEEQIEVEETIEAAKAEEAKDEPPSEGEAEEE
EKEKEEAEEEEAAEEEEAAKEESEEAKEEEAGGEGEEGAKVEEAAKVEEAKVEEGAKVEE
AKVEEGEETKEAEEEEKKDEGAGEEQAAKKKD
NT seq 1719 nt   +upstreamnt  +downstreamnt
atgagttccttcagctacgagccgtactactcgacctcctacaagcggcgctacatggag
actccccgggtgcacatctccagcgtgcgcagcggctacagcaccgcgcgctccgcttac
tccagctactcggcgcccgtctcctcctcgctgtccgtgcgccgcagttactcttccagc
tctggctccttgatgcccagtctcgagaaccttgacctgagccaggtggccgccatcagc
aacgacctcaagtctatccgcacccaggagaaggcgcagctgcaggacctcaacgaccgc
ttcgccagcttcatcgagcgcgtgcacgagctggagcagcagaacaaggtcctggaagct
gagctgctggtgctgcgccagaagcactccgagccctcccgcttccgggcgctgtacgag
caggagatccgcgacctgcgcctggcggcggaagacgccaccaacgagaagcaggcgctc
cagggcgagcgcgaagggctggaggagaccctgcgcaacctgcaggcgcgctatgaagag
gaggtgctgagccgcgaggacgccgagggccggctgatggaagcccgcaaaggagccgac
gaggcggctctcgcccgcgccgagctcgaaaagcgcatcgacagcctgatggacgaaatc
gcctttctgaagaaagtgcacgaagaggagatcgccgagctgcaggcgcagatccagtac
gcgcagatctccgtggagatggacgtgtcctccaagcccgacctctccgccgcgctcaag
gacatccgcgcccagtacgagaagctggccgccaagaacatgcagaacgccgaagagtgg
ttcaagagccgcttcaccgtgctgaccgagagcgccgccaagaacaccgacgcggtgcgc
gccgccaaggacgaggtgtccgagagccgccgcctgctcaaggccaagaccctggagatc
gaagcgtgccggggcatgaacgaagcgctggagaagcagctgcaggagctggaggacaag
cagaacgccgacattagtgctatgcaggacacaatcaacaaattagaaaatgaattgaga
accacgaagagtgagatggcgcgatacctgaaggaataccaagacctccttaacgtgaag
atggccttggacatcgagattgcagcatacaggaaactcttggaaggtgaagagacccga
ctcagtttcaccagcgtgggaagcataaccagcggctacacccagacctcccaggtcttt
ggccgatctgcctacggcggtttacagaccagctcctacttgatgtccgcccgctccttc
ccaacctactacaccagccacgtccaggaggagcagatcgaggtggaggagaccattgag
gctgcgaaagccgaggaagccaaggacgagcccccctctgaaggagaagctgaagaggag
gagaaggagaaggaagaggctgaggaagaggaggcagctgaagaggaagaagctgccaag
gaagaatctgaggaggccaaggaggaagaagcaggaggtgagggtgaagaaggagctaaa
gtagaagaagcagcaaaagttgaagaagctaaagtagaagaaggagctaaagtagaagaa
gctaaagttgaagaaggagaagaaaccaaagaagctgaggaggaggagaaaaaagatgaa
ggtgccggggaggagcaagcagccaagaagaaagattga

DBGET integrated database retrieval system