KEGG   Equus caballus (horse): 100054305
Entry
100054305         CDS       T01058                                 

Gene name
ADCY4
Definition
(RefSeq) adenylate cyclase type 4 isoform X1
  KO
K08044  adenylate cyclase 4 [EC:4.6.1.1]
Organism
ecb  Equus caballus (horse)
Pathway
ecb00230  Purine metabolism
ecb01100  Metabolic pathways
ecb01522  Endocrine resistance
ecb04015  Rap1 signaling pathway
ecb04020  Calcium signaling pathway
ecb04022  cGMP-PKG signaling pathway
ecb04024  cAMP signaling pathway
ecb04062  Chemokine signaling pathway
ecb04072  Phospholipase D signaling pathway
ecb04114  Oocyte meiosis
ecb04211  Longevity regulating pathway
ecb04213  Longevity regulating pathway - multiple species
ecb04261  Adrenergic signaling in cardiomyocytes
ecb04270  Vascular smooth muscle contraction
ecb04371  Apelin signaling pathway
ecb04540  Gap junction
ecb04611  Platelet activation
ecb04713  Circadian entrainment
ecb04714  Thermogenesis
ecb04723  Retrograde endocannabinoid signaling
ecb04724  Glutamatergic synapse
ecb04725  Cholinergic synapse
ecb04727  GABAergic synapse
ecb04742  Taste transduction
ecb04750  Inflammatory mediator regulation of TRP channels
ecb04911  Insulin secretion
ecb04912  GnRH signaling pathway
ecb04913  Ovarian steroidogenesis
ecb04914  Progesterone-mediated oocyte maturation
ecb04915  Estrogen signaling pathway
ecb04916  Melanogenesis
ecb04918  Thyroid hormone synthesis
ecb04921  Oxytocin signaling pathway
ecb04923  Regulation of lipolysis in adipocytes
ecb04925  Aldosterone synthesis and secretion
ecb04926  Relaxin signaling pathway
ecb04927  Cortisol synthesis and secretion
ecb04928  Parathyroid hormone synthesis, secretion and action
ecb04934  Cushing syndrome
ecb04935  Growth hormone synthesis, secretion and action
ecb04970  Salivary secretion
ecb04971  Gastric acid secretion
ecb04972  Pancreatic secretion
ecb04976  Bile secretion
ecb05032  Morphine addiction
ecb05163  Human cytomegalovirus infection
ecb05166  Human T-cell leukemia virus 1 infection
ecb05200  Pathways in cancer
ecb05414  Dilated cardiomyopathy (DCM)
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    100054305 (ADCY4)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    100054305 (ADCY4)
   04371 Apelin signaling pathway
    100054305 (ADCY4)
   04020 Calcium signaling pathway
    100054305 (ADCY4)
   04072 Phospholipase D signaling pathway
    100054305 (ADCY4)
   04024 cAMP signaling pathway
    100054305 (ADCY4)
   04022 cGMP-PKG signaling pathway
    100054305 (ADCY4)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    100054305 (ADCY4)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    100054305 (ADCY4)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100054305 (ADCY4)
   04062 Chemokine signaling pathway
    100054305 (ADCY4)
  09152 Endocrine system
   04911 Insulin secretion
    100054305 (ADCY4)
   04923 Regulation of lipolysis in adipocytes
    100054305 (ADCY4)
   04912 GnRH signaling pathway
    100054305 (ADCY4)
   04913 Ovarian steroidogenesis
    100054305 (ADCY4)
   04915 Estrogen signaling pathway
    100054305 (ADCY4)
   04914 Progesterone-mediated oocyte maturation
    100054305 (ADCY4)
   04921 Oxytocin signaling pathway
    100054305 (ADCY4)
   04926 Relaxin signaling pathway
    100054305 (ADCY4)
   04935 Growth hormone synthesis, secretion and action
    100054305 (ADCY4)
   04918 Thyroid hormone synthesis
    100054305 (ADCY4)
   04928 Parathyroid hormone synthesis, secretion and action
    100054305 (ADCY4)
   04916 Melanogenesis
    100054305 (ADCY4)
   04925 Aldosterone synthesis and secretion
    100054305 (ADCY4)
   04927 Cortisol synthesis and secretion
    100054305 (ADCY4)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100054305 (ADCY4)
   04270 Vascular smooth muscle contraction
    100054305 (ADCY4)
  09154 Digestive system
   04970 Salivary secretion
    100054305 (ADCY4)
   04971 Gastric acid secretion
    100054305 (ADCY4)
   04972 Pancreatic secretion
    100054305 (ADCY4)
   04976 Bile secretion
    100054305 (ADCY4)
  09156 Nervous system
   04724 Glutamatergic synapse
    100054305 (ADCY4)
   04727 GABAergic synapse
    100054305 (ADCY4)
   04725 Cholinergic synapse
    100054305 (ADCY4)
   04723 Retrograde endocannabinoid signaling
    100054305 (ADCY4)
  09157 Sensory system
   04742 Taste transduction
    100054305 (ADCY4)
   04750 Inflammatory mediator regulation of TRP channels
    100054305 (ADCY4)
  09149 Aging
   04211 Longevity regulating pathway
    100054305 (ADCY4)
   04213 Longevity regulating pathway - multiple species
    100054305 (ADCY4)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100054305 (ADCY4)
   04714 Thermogenesis
    100054305 (ADCY4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100054305 (ADCY4)
  09165 Substance dependence
   05032 Morphine addiction
    100054305 (ADCY4)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy (DCM)
    100054305 (ADCY4)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100054305 (ADCY4)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100054305 (ADCY4)
   05163 Human cytomegalovirus infection
    100054305 (ADCY4)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    100054305 (ADCY4)
Enzymes [BR:ecb01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     100054305 (ADCY4)
SSDB
Motif
Pfam: Guanylate_cyc DUF1053 AC_N
Other DBs
NCBI-GeneID: 100054305
NCBI-ProteinID: XP_005603310
Ensembl: ENSECAG00000013004
VGNC: 15089
UniProt: F6ZH58
Position
1
AA seq 1077 aa
MARLFSPRPQPSEDLFYETYYSLSQQYPLLLMLLAIVLCALLALLAVAWASGRELASDTG
FLTTVLCALGGFSLLLGLASREHRLQRWTRPLSGLVWAALLALGYSFLFTGGVVSAWDQV
SFFLFVIFTVYAMLPLGMRDATAAGLASSLSHLLVLGLYLGPQPDSRPALLPQLAANAVL
FLCGNVAGAYHKALMERALRATFREALSSLHSRRRLDTEKKHQEHLLLSILPAYLAQEMK
AEIMARLQAGQGSRPESTNNFHSLYVKRHQGVSVLYADIVGFTRLASECSPKELVLMLNE
LFGKFDQIAKEHECMRIKILGDCYYCVSGLPLSLPDHAINCVRMGLDMCRAIRKLRAATG
VDINMRVGVHSGSVLCGVIGLQKWQYDVWSHDVTLANHMEAGGVPGRVHITGATLALLAG
AYAVEDAAMEHRDPYLRELGEPTYLVIDPRAEEEDEKGTAGGLLSSLEGPKMRPSLLMTR
YLESWGAAKPFAHLSHVESPVSTSTPLPEKALASFSPQWSLDRSRTPRGLDEELDTGDAK
FFQVIEQLNSQKQWKQSKDFNPLTLYFREKEMEKEYRLSALPAFKYYTACTFLVFLSIFI
VQMLVTNRPPALAITYSITFLLFLLLLFICFSEHLTRCVLKGPKVLHWLPALSGLVSTRP
GLRVALGTATILLVFAMAITSLFFLPPASKCPFQAPNVSSMALNLSWELPGSLPLISIPY
SMHCCVLGFLSCSLFLHMSFELKLLLLLLWLTASCSLFLHSHAWLSDCLIARLYLGPADS
RPGVLKEPKMMGAISFFIFFFTLLVLARQNEYYCRLDFLWKKKLRQEREETETMENLTRL
LLENVLPAHVAPQFIGQNRRNEDLYHQSYECVCVLFASVPDFKEFYSESNINHEGLECLR
LLNEIIADFDELLSKPKFSGVEKIKTIGSTYMAATGLNATSGQDAQQDAERSCSHLGTMV
EFTVALGSKLDVINKHSFNNFRLRVGLNHGPVVAGVIGAQKPQYDIWGNTVNVASRMEST
GVLGKIQVTEETARALQSLGYTCYSRGVIKVKGKGQLCTYFLNTDLTRTGPPSAALG
NT seq 3234 nt   +upstreamnt  +downstreamnt
atggcccgcctcttcagtccccggccgcagcccagcgaagacctcttctacgagacctac
tacagcctgagccagcagtacccactgctgctaatgctgctggccatcgtgctctgcgcg
ctcctggcgctgctcgcggtcgcctgggccagtggcagggagctggcctctgacacgggc
ttcctgaccactgtgctgtgcgcgttgggcggcttctcgttgctgctgggcttggcttcc
cgcgagcaccgactgcagcgctggacgcgtcccctgtccggcctcgtgtgggcagcgctg
cttgcgctaggctacagcttcctgttcaccgggggcgtggtgagcgcctgggaccaggta
tcctttttcctctttgtcatcttcacggtctatgccatgctgcccttgggcatgcgggac
gccaccgccgcgggcctcgcctcctcactctcacatctgctggttcttgggctgtatctt
gggcctcaacccgactctaggcccgcgctgctgcctcagctggcagcaaacgcggtattg
ttcctgtgcgggaacgtggctggagcgtaccacaaggcgctgatggagcgcgccctgcgc
gccacgttccgggaggcgctgagttccctgcactcgcgccggcggctggacaccgagaag
aagcaccaggaacaccttctcttgtccatccttcctgcctacttggcccaagagatgaag
gcagagatcatggcacggctgcaggctggacaggggtcacggccagagagcaccaacaac
ttccatagcctctatgtcaagaggcaccagggagtcagcgtgctgtatgctgacatcgtg
ggcttcacgaggctggccagtgagtgctcccctaaagagttggtgctcatgctcaacgag
ctctttggcaagttcgaccagatcgccaaggagcatgaatgcatgcggatcaagatcctg
ggagactgttactactgtgtctccgggctgccactctcgctgccagaccacgccatcaac
tgcgtgcgcatggggctggacatgtgccgggccatcaggaaacttcgggcagccactggt
gtggacatcaacatgcgtgtgggtgtgcactcaggcagcgtgctctgcggagtcatcggg
ctgcagaagtggcagtacgatgtctggtcgcatgacgtcacactggccaaccacatggag
gccggtggcgtgccagggcgcgtacatatcacaggggctaccctggccctgctggcaggg
gcttatgctgtggaggatgcagccatggaacaccgagacccgtaccttcgggagctaggg
gagcctacctacctggtcatcgatccccgggctgaggaagaggatgagaagggcactgca
ggagggttgctgtcctctcttgagggccccaagatgcgtccatcactgctgatgacccgc
tacctggagtcctggggtgcagccaagccttttgcccacctgagccacgtagagagccca
gtgtccacctccactcctctcccggagaaggccctggcttccttcagcccccagtggagc
ctggaccggagccgtaccccccggggactagatgaggaattggacaccggggatgccaag
ttcttccaggtcattgaacagctcaactctcagaaacagtggaagcagtcgaaggacttc
aacccactgacactgtacttccgagagaaggagatggagaaagagtatcgactctctgca
ctccccgccttcaaatactacacagcctgcaccttcctggtttttctctccatcttcatc
gtccagatgctggtgacaaacaggcccccagctctggccatcacctatagtatcaccttc
ctcctcttcctcctcctcctcttcatctgtttctcagagcacctgacgaggtgtgtcttg
aaaggccccaaggtgctacactggctgcctgcactgtctggcctggtgtccacacggccc
ggactgcgagtcgccctgggcaccgccaccatccttctcgtcttcgccatggccattacc
agcctgttcttcttaccgccagcatcgaagtgccctttccaggctcccaatgtgtcctcc
atggctttgaacctctcctgggagctccctgggtccctgcctctcatcagcatcccatac
tccatgcactgctgcgtgctgggtttcctctcctgctccctctttctgcacatgagcttc
gaactgaagctgctgctgctcctgctgtggctgacggcctcctgctccctcttcttgcac
tcccacgcctggctgtctgactgcctcatcgcccgcctctatctgggccccgcggattcc
aggccaggggtgctgaaggagcccaaaatgatgggcgctatctccttcttcatcttcttc
tttaccctccttgtcctggctcggcagaatgaatattactgccgcctggacttcctgtgg
aagaagaagctgaggcaggagcgggaggagacagagacaatggagaacctgacccggctg
ctcttggagaatgtgctccctgcgcacgtggccccccagttcattggccagaaccggcgc
aacgaggatctctaccaccagtcgtacgagtgtgtttgtgtcctcttcgcctccgtccca
gacttcaaggagttttactctgaatccaatatcaaccacgagggcctagagtgtctgcgg
ctgctcaatgagataattgctgattttgatgagctgctctccaagcccaaattcagtggc
gtggagaagatcaaaaccattggcagcacctacatggcagctacaggcttaaatgccacc
tctggacaggacgcacagcaggatgctgagcgaagttgcagccaccttggcaccatggtg
gaattcacggtggccctcgggtctaagctagatgtcatcaacaagcactcattcaacaac
ttccgcttgcgtgtgggattgaaccacggaccagtagtggctggagtgattggggcccag
aagccacaatacgacatctggggcaacacggtgaacgtggccagccgcatggagagtaca
ggagtcctgggcaagatccaagtgactgaagagacagctcgggccctgcagtctttaggc
tacacctgctacagccggggtgtcatcaaggtcaaaggcaaagggcagctctgcacctac
ttcctgaacacagatttgacacgaactggacctccctctgccgccctgggctga

DBGET integrated database retrieval system