KEGG   Equus caballus (horse): 100054552Help
Entry
100054552         CDS       T01058                                 

Gene name
CDC27
Definition
(RefSeq) cell division cycle protein 27 homolog isoform X6
  KO
K03350  anaphase-promoting complex subunit 3
Organism
ecb  Equus caballus (horse)
Pathway
ecb04110  Cell cycle
ecb04114  Oocyte meiosis
ecb04120  Ubiquitin mediated proteolysis
ecb04914  Progesterone-mediated oocyte maturation
ecb05166  HTLV-I infection
Module
ecb_M00389  APC/C complex
Brite
KEGG Orthology (KO) [BR:ecb00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    100054552 (CDC27)
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    100054552 (CDC27)
   04114 Oocyte meiosis
    100054552 (CDC27)
 Organismal Systems
  Endocrine system
   04914 Progesterone-mediated oocyte maturation
    100054552 (CDC27)
 Human Diseases
  Infectious diseases
   05166 HTLV-I infection
    100054552 (CDC27)
Protein phosphatases and associated proteins [BR:ecb01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     100054552 (CDC27)
Ubiquitin system [BR:ecb04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   APC/C
    Other subunits
     100054552 (CDC27)
Chromosome and associated proteins [BR:ecb03036]
 Eukaryotic Type
  Sister chromatid separation proteins
   APC/C complex
    100054552 (CDC27)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TPR_1 TPR_2 ANAPC3 TPR_8 TPR_12 TPR_11 TPR_17 TPR_16 TPR_19 TPR_14 TPR_6 TPR_9 ChAPs TPR_20 TPR_21 Cas_Cas02710
Motif
Other DBs
NCBI-GeneID: 100054552
NCBI-ProteinID: XP_001501593
Ensembl: ENSECAG00000009635
VGNC: 49337
UniProt: F6RN71
Position
11
AA seq 825 aa AA seqDB search
MTVLQEPVQAAIWQALNHYAYRDAVFLAERLYAEVHSEEALFLLATCYYRSGKAYKAYRL
LKGHSCTTPQCKYLLAKCCVDLSKLAEGEQILSGGVFNKQKSHDDIVTEFGDSACFTLSL
LGHVYCKTDRLAKGSECYQKSLSLNPFLWSPFESLCEIGEKPDPDQTFKLTSLQNFSNCL
PNSCTTLVSNHNLSHRQPETVLTETPQDTIELNRLNLESSNSKYSLNTDSSVSYIDSAVI
SPDTVPLGTGTSILSKQVQNKPKTGRSLLGGPAALSPLTPSFGILPLETPSPGDGSYLQN
YTNTSSVIDVPSTGAPSKKSVARIGQTGTKSVFSQSGNSREVTPILVAQTQSSGPQTSTT
PQVLSPTITSPPNALPRRSSRLFTSDSSTTKENSKKLKMKFPPKIPNRKTKSKTNKGGIT
QPNINDSLEITKLDSSIISEGKISTITPQIQAFNLQKAAAEGLMSLLREMGKGYLALCSY
NCKEAINILSHLPSHHYNTGWVLCQIGRAYFELSEYMQAERIFSEVRRIENYRVEGMEIY
STTLWHLQKDVALSVLSKDLTDMDKNSPEAWCAAGNCFSLQREHDIAIKFFQRAIQVDPN
YAYAYTLLGHEFVLTEELDKALACFRNAIRVNPRHYNAWYGLGMIYYKQEKFSLAEMHFQ
KALDINPQSSVLLCHIGVVQHALKKSEKALDTLNKAIVIDPKNPLCKFHRASVLFANEKY
KSALQELEELKQIVPKESLVYFLIGKVYKKLGQTHLALMNFSWAMDLDPKGANNQIKEAI
DKRYLPDDEEPITQEEQIMGTDESQESSMTDADDTQLHAAESDEF
NT seq 2478 nt NT seq  +upstreamnt  +downstreamnt
atgacggtgctgcaggaacccgtccaggctgctatatggcaagcactaaaccactatgct
taccgagatgcagttttccttgcagaacgactgtatgcagaagtacactcagaagaagcc
ttgtttttactggcaacctgttactaccgctcaggaaaggcatacaaagcatatagactc
ttgaaaggacacagttgtactacaccacagtgtaaatacctgcttgcaaaatgttgtgtt
gatctcagcaagcttgcagaaggggaacagatcttatctggtggagtgtttaataagcag
aaaagccatgatgatattgttactgagtttggtgattcagcttgctttactctttcatta
ttgggacatgtatattgcaagacagatcggcttgccaaaggatcagaatgttaccaaaag
agccttagtttaaatcctttcctctggtccccctttgaatcattatgtgaaataggtgaa
aagccagatcctgaccaaacatttaaattaacatctttacagaactttagcaactgtctg
cccaactcttgcacaacgctagtatctaatcataatttatctcacagacagcctgagaca
gttcttacagaaacaccccaggatacaattgaattaaacagactgaatttagaatcttcc
aattcaaagtactccttgaatacggattcctcagtgtcttatattgattcagctgtaatt
tcaccagatactgttcctcttggaacaggaacttccatattatctaaacaggttcaaaat
aaaccaaaaactggtcgaagcttattaggaggaccagctgctcttagcccattaacccca
agttttgggattttgccattagaaacaccaagtcctggagatggatcctatttacaaaac
tacactaatacatcttctgtaattgacgtgccatccaccggagccccttcaaaaaagtct
gttgccagaatcggccaaactggaacaaagtctgtcttctcacagagtggaaatagtcga
gaggtaactccaattcttgttgcacagacacaaagttctggcccacaaacaagcaccaca
cctcaggtattgagccccactatcacatcccccccaaatgcactgcctcgaagaagttca
cgactttttactagtgacagctctacaaccaaggagaatagcaaaaaattaaaaatgaaa
tttccacctaaaatcccaaacagaaaaacaaagagtaaaactaataaaggaggaataact
caacctaacataaatgatagcctggaaattacaaaattggactcttccatcatttcagaa
gggaaaatctccacaatcacacctcagatccaggcatttaatctacagaaagcagcagca
gaaggtttgatgagccttcttcgtgaaatggggaaaggttatttagctttgtgttcatac
aactgcaaagaagctataaatattttgagccacctaccttctcaccactacaatactggt
tgggtactgtgccaaattggaagggcctattttgaactttcagagtacatgcaagctgaa
agaatattctcagaggttagaaggattgagaattacagagttgaaggcatggagatctac
tctacaacactttggcatcttcaaaaagatgttgctctttcagttctttcaaaagactta
acagacatggataaaaattcaccagaggcctggtgtgctgcagggaactgtttcagtttg
caacgggaacatgatattgcaattaaattcttccagagagctatccaggttgatccaaat
tatgcttatgcctatactctgttagggcatgagtttgtgttaactgaagaattagacaaa
gcattggcttgttttcgaaatgctatcagagtcaatcctagacattataatgcatggtat
ggtttaggaatgatttattacaagcaagaaaaattcagccttgcagaaatgcatttccag
aaagcactggatatcaaccctcaaagttcagttttactttgccacattggagtcgttcag
catgcactgaaaaaatctgagaaggctttggataccctaaacaaagccattgttattgat
cccaagaaccctctatgcaaatttcacagagcctcagttttatttgcaaatgaaaaatat
aagtctgctttacaagaacttgaagaattgaaacaaattgttcccaaagaatccctcgtt
tacttcttaataggaaaggtttacaagaagttaggtcaaacgcacctcgccctgatgaat
ttctcttgggctatggatttagatcctaaaggagccaataaccagattaaagaggcaatt
gataaacgctaccttccagatgatgaggagccaataacccaagaagaacagatcatggga
acagatgaatcccaggagagcagcatgacagatgcggatgacacacaacttcatgcagct
gaaagtgatgaattttaa

DBGET integrated database retrieval system