KEGG   Equus caballus (horse): 100054575
Entry
100054575         CDS       T01058                                 
Symbol
NFASC
Name
(RefSeq) neurofascin isoform X3
  KO
K06757  neurofascin
Organism
ecb  Equus caballus (horse)
Pathway
ecb04514  Cell adhesion molecules
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    100054575 (NFASC)
SSDB
Motif
Pfam: Ig_3 I-set Ig_2 fn3 ig Bravo_FIGEY V-set Ig_5 C2-set_2 BiPBP_C
Other DBs
NCBI-GeneID: 100054575
NCBI-ProteinID: XP_014594987
Ensembl: ENSECAG00000011985
VGNC: 20701
Position
5:1372039..1548110
AA seq 1448 aa
MRRLAARGAAGDAGEVAAPAADSTHCAQGRSPSPPRLIDVCAIWDTGVLPPTADWKGASS
GVAGARLNEAETLSSIQEAQLERLEVATPCGPGSRERGPVLRMARQQLPPWVHAAILLCL
LSLGRAIEIPMDPSIQNELSQPPTITKQSVKDHIVDPRDNILIECEAKGNPAPSFHWTRN
SRFFNIAKDPRVSMKRRSGTLVIDFRSGGRPEEYEGEYQCFARNKFGTALSNRIRLQVSK
SPLWPKENLDPVVVQEGAPLTLQCNPPPGLPSPVIFWMSSTMDPITQDKRVSQGHNGDLY
FSNVMLQDMQTDYSCNARFHFTHTIQQKNAFTLKVLTNHPHNDSSLRNHPDMYSARGVAE
RTPSFMYPQGTASSQMVLRGMDLLLECIASGVPTPDIAWYKKGGDLPSDKAKFENFNKAL
RITNVSEEDSGEYFCLASNKMGSIRHTISVRVKAAPYWLDEPKNLILAPGEDGRLVCRAS
GNPKPTIQWMVNGEPLQSAPPNPNREVAGDTIIFRDTQISSRAVYQCNTSNEHGYLLANA
FVSVLDVPPRMLSPRNQLIRVILYNRTRLDCPFFGSPIPTLRWFKNGQGSNLDGGNYHVY
ENGSLEIKMIHKEDQGIYTCVATNILGKAENQVRLEVKDPTRIFRMPEDQVAKRGTTVQL
ECRVKHDPSLKLTVSWLKDDEPLYIGNRMKKEDDSLTIFGVAERDQGSYTCVASTELDQD
LAKAYLTVLGRPDRPRDLELTDLAERSVRLTWIPGDDNNSPITDYVVQFEEDQFQPGVWH
DHSKFPGSVNSAVLQLSPYVNYQFRVIAINEVGSSHPSLPSERYRTSGAPPESNPADVKG
EGTRKNNMEITWTPMNATSAFGPNLRYIVKWRRRETRESWNNVTVWGSRYVVGQTPVYVP
YEIRVQAENDFGKGPEPDTVIGYSGEDYPRAAPTDVKIRVLNSTAISLQWNRVYSDTVQG
LLREYRAYYWRESSLLKSLWVSQKRQQASFPGDRLRGVVPRLFPYSNYKLEMVVVNGRGD
GPRSETKEFTTPEGVPSAPRRFRVRQPNLETINLEWDHPEHPNGILTGYTLRYVPFNGTK
VGKQIVENFSPNQTKFTVQRADPVSRYRFTLSARTQVGSGEAVTEESPAPPNEATPTAAP
PTLPPTTVGTVSSTDATVTAATTEATTVPIIPTVAPATIATTTVATTTTTTAATTTTTTE
GPPTTTTGTKIHESAPDEQSIWNVTVLPNSKWANITWKHNFGPGTDFVVEYIDSNHTKKS
VPVKAQAQPVQLTDLYPGMTYTLRVYSRDNEGISSTVITFMTSTAYTNNQADIATQGWFI
GLMCAIALLVLILLIVCFIKRSRGGKYPVREKKDVPLGPEDPKEEDGSFDYSDEDNKPLQ
GSQTSLDGTIKQQESDDSLVDYGEGGEGQFNEDGSFIGQYTVKKDKEETEGNESSEATSP
VNAIYSLA
NT seq 4347 nt   +upstreamnt  +downstreamnt
atgcggcggctggcggcgagaggcgctgcaggggacgcgggggaagtggcggcgccggcc
gcggacagcacgcactgcgcccagggccggagccctagccctccgaggttgattgacgta
tgtgccatttgggatactggagttctccctcccaccgcagactggaagggagcctcctcg
ggggttgcaggggcgaggctgaatgaggcagagacgctgagctctatccaggaggcccag
ttagaacggctggaggtggccacaccctgcgggccggggagcagggagcggggccccgtg
ctgaggatggccaggcagcagctgccaccctgggtccatgcagccatcctcctctgcctc
ctcagcctcggccgggccatcgagattcctatggatccaagcattcagaacgagctgtcc
cagcctccgaccatcaccaagcagtcggtgaaggaccacatcgtggatccccgggataac
atcctgattgagtgtgaggcgaaggggaaccccgcccccagcttccactggactcgcaac
agcaggttcttcaacatcgccaaggacccccgggtgtccatgaagaggcggtctgggacc
ctggtgatcgacttccgcagcggcgggcggccagaggagtacgagggggaataccagtgc
ttcgcccgcaacaagttcggcaccgccctgtccaacaggatccgcctgcaggtgtccaaa
tctcccctgtggcccaaggaaaacctagaccctgtcgtggtccaagaaggcgcccccttg
acactccagtgtaaccccccgcctggacttccgtccccagtcatcttctggatgagcagc
accatggaccccatcacccaagacaagcgtgtctcccagggccacaacggagacctgtat
ttctccaacgtcatgctgcaggacatgcagactgactacagctgcaatgcccgcttccac
tttacccacaccatccagcagaagaacgcgttcaccctcaaggtcctcaccaaccacccc
cataatgactcgtccttaagaaaccaccctgacatgtacagtgcccgaggagttgcggaa
aggacacccagcttcatgtatccccagggcactgcgagcagccagatggtgctgcgtggc
atggacctcctgctggagtgcatcgcctccggggtcccgacaccagacatcgcgtggtac
aagaaaggtggggacctcccatctgacaaggccaagtttgagaactttaacaaggctcta
cgtatcaccaatgtctctgaggaagactctggagagtatttctgcctggcctccaacaag
atgggcagcatccggcacacgatctcggtgagagtaaaggctgctccctactggctggat
gaacccaagaaccttatcctggctcctggcgaggacgggagactggtgtgtcgagccagt
gggaaccccaagcccaccatccagtggatggtgaatggggaacctttgcaatcggcacca
cccaacccaaaccgagaggtggccggggacaccatcatcttccgggacacgcagatcagc
agcagggccgtgtaccagtgcaacacgtccaacgagcacggctacctgctggccaacgcc
ttcgtcagcgtgctggacgtgccacctcggatgctgtcaccgcggaaccagcttattagg
gtgatcctgtacaaccggacgcggctggactgcccattctttgggtcccccattcccacg
ctccgttggtttaagaatggacaaggaagcaacctggatggaggcaactaccatgtctat
gagaatggcagtctggaaatcaagatgatccacaaagaggaccaaggcatctacacctgc
gttgccactaacatcctgggcaaggcagaaaaccaggtccgcctggaagtcaaagacccc
accaggatctttcggatgcctgaggaccaggttgccaagaggggcaccacggtgcagctg
gagtgccgggtgaagcacgacccctccctgaagctcacagtgtcctggctgaaggatgac
gagccgctctacatcgggaacaggatgaagaaggaagatgactccctgaccatctttggt
gtggcggagcgggaccagggcagttacacctgcgtcgccagcactgagctggaccaagac
ctggccaaggcctacctcaccgtgctaggacggccagacagaccccgggacctggagctc
actgacctggctgagaggagtgtgaggctcacctggatcccaggggatgacaacaatagc
cccatcacagactatgtcgtccagtttgaagaggaccagttccagccaggggtctggcat
gaccattccaagttcccaggcagtgtcaactcagctgtcctccagctgtccccatatgtc
aactaccagttccgggtcattgccatcaacgaggtcggcagcagccaccccagcctccca
tctgagcgctaccgaaccagcggagcaccccctgagtctaatcccgctgatgtgaaggga
gaggggaccagaaaaaacaacatggagatcacgtggacgcccatgaatgccacctccgcc
tttggccccaacctgcgctacatcgtgaagtggcggcggagagagactcgagagagctgg
aacaacgtcacagtgtggggctcccgctacgtggtgggtcagacccctgtctatgtgccc
tacgagatccgagtccaggccgaaaatgactttgggaagggccctgagccagacacggtc
atcggttactccggagaagattatcccagggctgcgcccaccgacgttaaaatccgagtg
ctgaacagcacggccatcagccttcagtggaaccgcgtctactccgacacggtccagggc
ctgctcagagagtaccgagcctactactggagagagagcagcttgctgaagagcttgtgg
gtgtctcagaagagacagcaggccagcttccctggtgaccgcctccgcggcgtggtgccc
cgcctcttcccctacagcaactacaagctggagatggttgtggtcaatgggagaggcgat
gggcctcgcagtgagaccaaggagttcacaaccccagaaggagtacccagtgcccccagg
cgattccgagtccggcagcccaacctggagaccatcaacctggaatgggaccatccggaa
caccccaatgggatcctgactggatacaccctcagatacgtgccctttaatggaaccaaa
gtaggaaagcagatagtggaaaacttctctcccaatcagaccaagttcacggtgcaaaga
gcagaccccgtgtcgcgctaccgctttaccctcagtgccaggacgcaggtgggctctggg
gaagctgtcacagaggagtcgccagcacccccgaatgaagctactccaaccgcagctcct
cccacgttgcccccgactacagtgggtactgtgagcagtactgatgctactgtcactgct
gccaccactgaagccacaacagtccccatcatcccaactgtcgcacctgccaccatcgct
accaccaccgtcgccacaactactacaaccactgccgccaccaccaccaccaccacggag
ggtcctcccaccaccaccaccgggactaagatacacgaatccgccccggacgagcagtcc
atatggaacgtcacagtgctccccaacagtaaatgggccaacatcacctggaagcacaat
ttcgggcccggaactgactttgtggttgagtacatcgacagcaaccatacgaaaaaaagt
gtccctgttaaggcccaggcgcagcctgtccagctgacagacctctatcccgggatgaca
tacacgttgcgagtctattcccgggacaacgagggcatcagcagtaccgtcatcaccttt
atgaccagtacagcttacaccaacaaccaggcggacatcgccacccagggctggttcatc
gggctcatgtgcgccatcgccctcctggtgctgattctgctcatcgtctgtttcatcaag
aggagtcgaggcggcaagtacccagtgcgagagaagaaggacgttcccctcggccctgaa
gaccccaaagaagaggacggctcctttgactacagtgatgaggacaacaagcccctgcag
ggcagccagacatccctggatggcaccatcaagcagcaggagagtgacgacagcctggtg
gactacggcgagggcggcgaggggcagttcaatgaggacggctcctttatcggccagtac
acagtcaaaaaggacaaggaggagacagagggcaatgaaagctcagaggccacgtcacct
gtcaacgccatctattctctggcctaa

DBGET integrated database retrieval system